Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR122 IGR125 IGR123 IGR120 IGR121 IGR119 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0146

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
182613

Gene Stop:
183098

Gene Length:
486

Molecular Weight*:
16556

pI*:
5.10

Net Charge*:
-2.15

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
161

PDB Hit:


Gene Protein Sequence:
MSSSEVVFQTVHGLGFGGLSSKSVVPFKKSLSDAPRVVCSILVLTLGLGA
LVCGIAITCWCVPGVILMGGICAIVLGAISLALSLFWLWGLFSNCCGSKR
VLPGEGLLRDKLLDGGFSRAAPSGMGLPGDGSPRASTPSCLEELQAEIQA
VTQAIDQMSDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAGTTCGGAAGTTGTTTTCCAGACAGTTCATGGCCTTGGCTTTGG
TGGATTGTCTTCAAAAAGTGTTGTCCCTTTTAAGAAAAGTCTTTCGGATG
CGCCCCGTGTTGTGTGCTCGATTTTAGTTTTGACTCTGGGGTTGGGAGCG
CTTGTTTGTGGTATTGCCATTACTTGTTGGTGTGTCCCGGGAGTTATTTT
AATGGGGGGAATTTGCGCTATAGTTTTAGGTGCAATTTCTTTAGCTTTAA
GTCTATTTTGGTTGTGGGGTTTATTTTCTAATTGTTGTGGTTCTAAGAGA
GTTTTACCGGGTGAGGGATTGCTACGGGATAAGCTTTTAGATGGTGGATT
TTCAAGAGCGGCACCTTCAGGAATGGGACTTCCGGGTGATGGATCTCCAA
GAGCGTCAACGCCATCTTGCCTAGAGGAACTTCAAGCAGAGATACAGGCA
GTTACTCAAGCTATCGATCAGATGTCAGATGATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy