Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR122 IGR123 IGR120 IGR121 IGR119 CPn0143 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0143 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0143 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0145

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
180777

Gene Stop:
182372

Gene Length:
1596

Molecular Weight*:
60238

pI*:
6.50

Net Charge*:
-2.63

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0145 is orthologously related to CT114, a hypothetical protein: residues 46-518 are 46%
similar to CT114.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
321  
348

PDB Hit:


Gene Protein Sequence:
MFKSFIVRYMFVGGLVSFLLPIPDLECANNVTKTYDKKASVISRDLKLQE
DCQKFWNLDPYKLESLCAYQVLYHDDYSSKRIRELFPQIQKDEVPIFATM
ILTLGKVDRGFSPEEISLIQKLSYPGLSLASLRGSTEIDPNTDLARALVV
SEFSGDLGKNRADYYSNCLDILALRIHAERQRYLDQSPCVPGTSEFHKAT
IEAINTILFYEEAVRYPSKKEMFSDEFSFLSSVTDRKFGVCLGVSSLYFS
LSQRLDLPLEAVTPPGHIYLRYQGGEVNIETTAGGRHLPTASYCDCLDLE
DLQVRTPEEMIGLTFMNQGSFALQKKKYKEAEEAYKKAQEYLGDEELQEL
LGFVQILGGKKKEGKSLIGKSPRASQKGSVAYDYLKGRINIPTLALLFSY
PGSNYEEIASYEEELKKAMKSSMPCCEGQRRLASVAFHLGKTAEAVALLE
KCVEDIPNDLSLHLRLCKILCDRHEYTKALKYFIIAERLMEDQGFLKKDN
RSFALFYEVKKIISKVAPQKANTLLLMESER$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAGAGCTTTATAGTAAGGTATATGTTTGTAGGTGGCCTTGTTTC
ATTCTTGCTTCCTATCCCCGACTTGGAATGTGCGAATAATGTAACAAAAA
CTTATGATAAGAAAGCTTCTGTTATATCCAGAGATCTTAAGCTACAGGAA
GACTGCCAGAAGTTTTGGAATCTTGATCCGTATAAACTAGAAAGTCTTTG
TGCTTATCAAGTGCTTTACCATGATGACTATAGTTCCAAGAGAATACGAG
AGCTTTTTCCTCAAATCCAAAAAGACGAAGTCCCCATATTTGCAACAATG
ATTCTTACTTTAGGGAAAGTAGACCGTGGCTTTTCTCCTGAAGAAATTTC
ATTGATCCAAAAACTTTCTTACCCAGGCCTCTCATTGGCTTCTTTGAGAG
GGTCTACAGAAATAGACCCGAATACAGATTTGGCTCGTGCTTTAGTAGTG
TCGGAGTTTTCTGGAGATTTAGGGAAGAACCGAGCTGACTACTATAGCAA
TTGCCTTGATATTTTGGCGTTGCGTATTCATGCAGAACGTCAAAGGTATT
TAGATCAGTCTCCTTGTGTTCCTGGAACCTCCGAGTTTCATAAGGCAACT
ATAGAAGCTATTAATACGATACTCTTCTATGAAGAAGCAGTTCGTTATCC
TTCGAAGAAAGAAATGTTTTCTGATGAATTTTCTTTTCTTTCTTCAGTTA
CAGATAGAAAATTCGGCGTATGTTTAGGGGTCTCTTCTCTTTATTTCTCT
TTGTCACAGCGCTTAGATTTACCTTTAGAGGCTGTGACGCCTCCTGGGCA
TATCTACTTACGTTATCAGGGTGGTGAGGTGAACATTGAGACTACAGCTG
GAGGGCGCCATCTTCCTACAGCAAGTTACTGTGATTGTCTAGATTTAGAA
GACCTTCAGGTGCGTACTCCTGAAGAAATGATAGGGCTTACTTTTATGAA
CCAGGGCTCTTTTGCTCTGCAGAAGAAAAAGTATAAGGAAGCGGAAGAGG
CTTATAAAAAGGCTCAAGAGTATTTGGGAGACGAGGAACTACAAGAGCTT
TTGGGGTTTGTTCAAATCCTAGGAGGAAAGAAAAAAGAGGGGAAATCTTT
GATTGGTAAAAGTCCTCGCGCTTCCCAGAAAGGATCGGTGGCTTATGACT
ACCTTAAAGGTAGAATCAACATTCCAACACTAGCTCTTTTATTTTCTTAT
CCAGGATCCAATTATGAAGAGATAGCTTCTTATGAAGAAGAACTCAAAAA
GGCTATGAAAAGCTCGATGCCATGTTGTGAAGGACAGCGTCGTCTTGCTT
CAGTAGCATTTCATTTGGGGAAGACAGCGGAGGCGGTTGCTCTTTTAGAA
AAATGCGTTGAGGATATCCCTAATGATCTTTCTCTTCATTTAAGGTTATG
TAAAATCCTATGTGATCGACATGAGTATACAAAGGCTTTGAAATACTTCA
TAATTGCGGAAAGACTTATGGAGGATCAGGGATTTCTTAAAAAAGACAAT
CGTTCGTTCGCTTTATTTTATGAGGTGAAAAAAATCATATCCAAAGTGGC
TCCTCAAAAAGCTAACACCTTGCTTTTAATGGAGTCTGAAAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy