Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR118 IGR122 IGR123 IGR120 IGR121 IGR119 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 CPn0143 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 clpB, - CPn0144 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 CPn0143 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 clpB, - CPn0144 yqgE, - CPn0139 rpiA, - CPn0141 CPn0143 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 CPn0146 CPn0145 pkn1, - CPn0148 clpB, - CPn0144 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0144

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
clpB  

Definition:
ClpB-related ATP-dependent protease

Gene Start:
177963

Gene Stop:
180563

Gene Length:
2601

Molecular Weight*:
96924

pI*:
5.30

Net Charge*:
-15.87

EC:
3.4.21.-  

Functional Class:
cellular processes; chaperones  

Pathway: pathway table

Secondary Evidence:
"THE ATP-DEPENDENT CLP PROTEASE OF ESCHERICHIA-COLI: SEQUENCE OF CLPA AND IDENTIFICATION OF A CLP-SPECIFIC SUBSTRATE." 1990. GOTTESMAN S, CLARK WP, MAURIZI MR. JOURNAL OF BIOLOGICAL CHEMISTRY 265(14): 7886-7893.

Comment:
CLPA, CLPB, CLPC are chaperone proteins, not regarded to be true heat-shock
proteins but which support degradation of denatured proteins under conditions
of high temperature. They have ATPase activity and provide subunit support
to an ATP-dependent protein, the ClpP.

For review, "New insights into the ATP-dependent Clp protease: Escherichia coli and beyond." 1999. Porankiewicz J, Wang JM, Clarke AK. MOLECULAR MICROBIOLOGY 32(3): 449-458.

Blast Summary:  PSI-Blast Search
CPn0144 is orthlogously related to CT113: residues 1-866 of CPn0144 are 84% similar to residues 1-866 of CT113, a predicted ClpB-related ATP-dependent protease from C. trachomatis.
CPn0144 is also similar to TP0071, MG355, UU391, CT286, TP0549, TP0801, all predicted Clp proteases.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0542
COG name: ATPases with chaperone activity, ATP-binding domain
Functional Class:  O
The phylogenetic pattern of COG0542 is --t-YQVCEBRhUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0144 is paralogously related to CPn0437: residues 2-863 of CPn0144 are 39% similar to residues 3-831 of CPn0437, a predicted ClpC protease from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 67 (E-value = 2.2e-12) place CPn0144 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 92 to 144 (E-value = 2.7e-09) place CPn0144 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 200 to 378 (E-value = 6e-09) place CPn0144 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 549 to 799 (E-value = 9.5e-05) place CPn0144 in the Torsin family which is described as Torsin (PF06309)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
77
coil-coil  
411  
522

PDB Hit:


Gene Protein Sequence:
MEKFSDAVSEALEKAFELAKSSKHTYVTENHLLLALLENTESLFYLVIKD
IHGNPGLLNTAVKDALSREPTVVEGEVDPKPSPGLQTLLRDAKQEAKTLG
DEYISGDHLLLAFWSSNKEPFNSWKQTTKVSFKDLKNLITKIRRGNRMDS
PSAESNFQGLEKYCKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNN
PMLIGEPGVGKTAIAEGLALRLIQGDVPESLKGKQLYVLDMGALIAGAKY
RGEFEERLKSVLKDVESGDGEHIIFIDEVHTLVGAGATDGAMDAANLLKP
ALARGTLHCIGATTLNEYQKYIEKDAALERRFQPIFVTEPSLEDAVFILR
GLREKYEIFHGVRITEGALNAAVLLSYRYIPDRFLPDKAIDLIDEAASLI
RMQIGSLPLPIDEKERELAALIVKQEAIKREQSPSYQEEADAMQKSIDAL
REELASLRLGWDEEKKLISGLKEKKNSLESMKFSEEEAERVADYNRVAEL
RYSLIPQLEEEIKQDEASLNQRDNRLLQEEVDERLIAQVVANWTGIPVQK
MLEGEAEKLLILEESLEERVVGQPFAVSAVSDSIRAARVGLNDPQRPLGV
FLFLGPTGVGKTELAKALADLLFNKEEAMVRFDMSEYMEKHSISKLIGSS
PGYVGYEEGGSLSEALRRRPYSVVLFDEIEKADKEVLNILLQVFDDGILT
DGKKRKVNCKNALFIMTSNIGSPELADYCSKKGSELTKEAILSVVSPVLK
RYLSPEFMNRIDEILPFVPLTKEDIVKIVGIQMRRIAQRLKARRINLSWD
DSVILFLSEQGYDSAFGARPLKRLIQQKVVILLSKALLKGDIKPDTSIEL
TMAKEVLVFKKVETPS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGAAATTTTCCGATGCTGTCTCTGAAGCTTTAGAGAAGGCTTTCGA
ACTTGCTAAATCTTCGAAACATACCTATGTCACAGAAAATCACCTATTAC
TGGCTTTATTAGAAAATACAGAGTCTCTCTTTTATTTGGTAATTAAGGAC
ATTCATGGGAACCCTGGTTTGCTCAATACGGCAGTTAAAGATGCGCTCTC
ACGAGAGCCGACTGTAGTTGAAGGAGAGGTGGATCCTAAACCTTCTCCGG
GTTTACAAACCCTTCTTAGGGATGCCAAACAAGAGGCAAAGACATTAGGA
GATGAATACATTTCTGGAGATCATCTGCTGCTTGCTTTTTGGAGTTCAAA
CAAAGAGCCTTTTAATTCTTGGAAGCAAACAACAAAAGTTAGTTTTAAAG
ATCTTAAGAATCTGATTACTAAAATACGACGAGGAAATCGTATGGATTCG
CCAAGCGCTGAAAGTAATTTTCAGGGTTTAGAAAAGTATTGTAAAAATTT
AACAGCATTAGCTCGTGAAGGTAAACTGGATCCTGTGATCGGTAGAGATG
AAGAAATTCGTAGAACCATCCAAGTGCTTTCCCGTAGAACTAAAAATAAC
CCTATGCTTATTGGTGAGCCGGGTGTAGGGAAAACTGCTATAGCAGAAGG
ATTAGCTCTTAGGCTTATCCAGGGTGATGTTCCTGAATCTCTCAAAGGTA
AACAGCTTTATGTCTTAGATATGGGAGCTTTGATTGCAGGAGCTAAGTAT
CGAGGTGAGTTTGAAGAAAGACTAAAGAGTGTTTTAAAAGATGTAGAATC
TGGAGATGGCGAGCACATTATCTTTATTGATGAGGTGCATACTCTTGTTG
GAGCAGGAGCTACTGATGGAGCTATGGATGCTGCGAATCTTTTAAAGCCT
GCATTAGCAAGAGGGACGCTACACTGTATTGGCGCGACGACTTTGAATGA
GTATCAGAAGTATATTGAAAAAGATGCTGCTTTGGAACGTCGATTTCAGC
CTATTTTTGTGACAGAGCCTTCTTTGGAGGATGCTGTCTTTATTCTTCGT
GGACTAAGAGAAAAATATGAAATTTTCCATGGAGTCAGGATTACAGAGGG
GGCTTTGAATGCCGCAGTCCTACTTTCCTATCGTTATATCCCAGATCGCT
TTCTTCCAGATAAGGCTATCGATTTGATAGATGAAGCGGCAAGTTTAATT
CGCATGCAAATTGGTAGTCTTCCTCTTCCTATTGATGAAAAGGAGAGAGA
GCTTGCTGCTTTGATCGTTAAGCAAGAGGCTATAAAACGCGAGCAATCTC
CTTCCTATCAAGAAGAGGCGGATGCTATGCAGAAGTCTATAGATGCTTTG
AGAGAGGAATTAGCATCTCTACGTTTGGGTTGGGATGAAGAGAAGAAGTT
GATTTCGGGGCTCAAGGAAAAAAAGAATTCCTTGGAAAGTATGAAATTTT
CTGAAGAGGAGGCGGAGCGTGTTGCAGACTATAATCGTGTAGCTGAGCTT
CGGTATAGTTTAATTCCCCAACTTGAAGAAGAAATCAAACAGGATGAAGC
CTCTTTAAATCAAAGAGATAACCGTCTCCTTCAAGAAGAAGTTGACGAGC
GATTGATTGCGCAAGTGGTAGCTAATTGGACAGGGATTCCTGTGCAAAAA
ATGCTAGAAGGGGAAGCTGAGAAACTGTTAATTCTTGAAGAATCCTTAGA
AGAACGTGTGGTAGGACAGCCTTTTGCAGTCTCTGCGGTTAGTGATTCTA
TTCGTGCTGCACGTGTAGGTTTAAATGATCCTCAACGTCCCTTAGGAGTC
TTTTTATTTTTAGGGCCAACAGGGGTAGGAAAAACCGAGCTTGCAAAAGC
TCTTGCAGATCTTCTTTTCAATAAAGAGGAAGCTATGGTCCGCTTCGATA
TGTCAGAGTATATGGAAAAGCATTCCATTTCCAAGCTTATAGGATCTTCT
CCAGGGTATGTGGGTTATGAGGAAGGTGGGAGTCTTTCTGAGGCTCTTCG
ACGACGTCCCTATTCAGTAGTTCTCTTTGATGAGATAGAGAAAGCAGATA
AGGAAGTTCTAAATATCCTTTTACAGGTTTTTGATGATGGGATTCTTACG
GATGGGAAAAAACGCAAAGTAAATTGTAAAAATGCCTTGTTTATCATGAC
ATCAAATATAGGTTCTCCAGAACTTGCAGATTATTGTTCAAAAAAAGGAA
GTGAGCTTACGAAAGAAGCGATTCTTTCTGTAGTCTCTCCAGTATTGAAA
AGATACTTGAGCCCTGAATTTATGAACCGAATTGATGAGATACTTCCTTT
TGTTCCATTAACGAAAGAAGATATCGTGAAAATAGTTGGCATTCAAATGC
GAAGGATTGCCCAGAGATTAAAGGCACGGCGGATCAATTTATCTTGGGAT
GATTCTGTAATATTATTTCTTAGTGAACAGGGTTATGACAGTGCTTTCGG
AGCCCGCCCTTTAAAACGTTTGATCCAACAAAAAGTTGTGATCTTGCTTT
CTAAGGCTTTGCTTAAAGGAGATATTAAACCTGATACATCGATTGAGTTG
ACGATGGCAAAAGAGGTGCTCGTATTTAAAAAAGTGGAAACTCCTTCTTA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy