Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR115 IGR118 IGR120 IGR114 IGR119 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 CPn0145 clpB, - CPn0144 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 CPn0145 clpB, - CPn0144 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 CPn0145 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0143

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
177335

Gene Stop:
176211

Gene Length:
1125

Molecular Weight*:
42833

pI*:
5.60

Net Charge*:
-10.17

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits in gapped BLAST to hypothetical protein sequences; e.g. residues 3-322 are 36% similar to YXJH_BACSU; residues 14-322 are 37% similar to YXJG_BACSU; and residues 15-343 are 21% similar to (AP000004) 338aa long hypothetical 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase [Pyrococcus horikoshii]. No similarity to C. trachomatis, M. genitalium, M. pneumoniae, U. urealyticum, T. pallidum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0620
COG name: Methionine synthase II (cobalamin-independent)
Functional Class:  E
The phylogenetic pattern of COG0620 is amtKyqv-eBrh-------N-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 6-322 are 37% similar to a defined domain of YXJH_BACSU.
Residues 243-343 are 29% similar to a defined domain of O58816_PYRHO, defined as: Methionine methyltransferase synthase 5-methyltetrahydropteroyltriglutamate--homocysteine cobalamin-independent vitamin-B12 independent isozyme protein transferase.

Paralogs:  Local Blast Search
Single highly significant hit in C.pneumoniae to a predicted hypothetical protein; residues 1-373 are 55% similar to CPn0448.

Pfam Summary:  Pfam Search
Residues 15 to 371 (E-value = 2.9e-06) place CPn0143 in the Methionine_synt family which is described as Methionine synthase, vitamin-B12 independent (PF01717)

PDB Hit:


Gene Protein Sequence:
MNTSLKRPLKSHFDVVGSFLRPEHLKKTRESLKEGSISLDQLMQIEDIAI
QDLIKKQKAAGLSFITDGEFRRATWHYDFMWGFHGVGHHRATEGVFFDGE
RAMIDDTYLTDKISVSHHPFVDHFKFVKALEDEFTTAKQTLPAPAQFLKQ
MIFPNNIEVTRKFYPTNQELIEDIVAGYRKVIRDLYDAGCRYLQLDDCTR
GGLVDPRVCSWYGIDEKGLQDLIQQYLLINNLVIADRPDDLVVNLHVCRG
NYHSKFFASGSYDFIAKPLFEQTNVDGYYLEFDHERSGDFSPLTFISGEK
TVCLGLVTSKTPTLENKDEVIARIHQAADYLPLERLSLSPQCGFASCEIG
NKLTEEEQWAKVALVKEISEEVWK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACTTCACTAAAAAGACCTCTGAAATCTCATTTTGATGTTGTCGG
TAGTTTTTTGCGTCCTGAGCATTTAAAAAAAACTAGAGAAAGCCTTAAAG
AAGGCTCTATTTCTCTAGATCAACTCATGCAAATTGAGGATATCGCTATC
CAAGATTTGATCAAAAAACAAAAAGCAGCAGGTCTTTCTTTTATTACTGA
TGGAGAATTCCGCAGAGCTACGTGGCATTACGACTTCATGTGGGGTTTTC
ATGGCGTAGGTCACCACAGAGCTACAGAAGGAGTTTTCTTTGATGGAGAA
CGCGCTATGATCGATGATACCTATCTGACAGACAAGATCTCTGTATCTCA
CCACCCATTTGTGGATCACTTTAAATTTGTAAAAGCTCTAGAAGATGAAT
TTACGACTGCAAAGCAAACTCTTCCTGCACCGGCACAGTTTTTAAAGCAG
ATGATCTTCCCTAATAATATAGAGGTCACACGTAAATTCTATCCTACAAA
TCAGGAGCTAATTGAAGATATTGTTGCAGGTTATCGTAAAGTCATTCGCG
ATCTTTATGATGCTGGCTGCCGCTATCTCCAATTAGATGACTGTACTCGG
GGAGGTTTAGTAGACCCTCGAGTCTGTTCGTGGTATGGTATCGATGAAAA
AGGTCTTCAAGATCTGATTCAACAATATCTTCTGATTAATAATCTTGTAA
TTGCAGATCGTCCCGATGATCTAGTCGTTAATTTACATGTATGCCGTGGG
AACTACCACTCAAAATTCTTTGCTAGTGGTAGTTATGACTTTATTGCAAA
GCCCCTATTCGAACAAACAAATGTAGACGGCTACTATTTAGAGTTTGATC
ATGAGCGTTCTGGAGACTTCTCTCCTCTCACCTTCATTTCTGGAGAAAAA
ACTGTCTGCTTAGGTCTTGTTACCAGCAAAACCCCTACACTTGAAAATAA
GGATGAGGTCATTGCTCGCATACATCAAGCAGCAGACTACCTGCCCTTGG
AAAGACTCTCTCTAAGTCCACAGTGTGGTTTTGCTTCATGTGAAATAGGA
AATAAATTAACAGAAGAAGAGCAATGGGCTAAAGTTGCTCTAGTAAAAGA
AATTTCCGAAGAAGTTTGGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy