Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR115 IGR113 IGR118 IGR120 IGR114 IGR119 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 CPn0145 clpB, - CPn0144 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 CPn0145 clpB, - CPn0144 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 CPn0145 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0142

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
176091

Gene Stop:
175813

Gene Length:
279

Molecular Weight*:
11028

pI*:
10.70

Net Charge*:
8.90

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LEKFHFKILQLLSTKNSILNFCSHFEISRVSHDNAIQKIRSYPLKPIAEN
RINTLSFKDLKIDYPKDSSKRFRFLYSIGRIPLHKLWEYFVT$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAAAAATTTCACTTCAAAATACTCCAACTATTGTCTACTAAGAATTC
CATTCTTAATTTTTGTTCGCACTTCGAGATTTCTAGAGTATCCCATGACA
ATGCAATACAAAAGATCCGTTCCTACCCACTAAAACCTATAGCAGAAAAT
AGGATCAATACGCTTTCATTTAAAGATCTGAAAATCGATTACCCTAAAGA
CTCGTCCAAAAGGTTTCGATTTTTGTATAGTATTGGAAGAATCCCTTTGC
ATAAGCTGTGGGAATATTTTGTAACATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy