Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR115 IGR113 IGR118 IGR114 IGR119 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0141

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpiA  

Definition:
ribose 5-phosphate isomerase

Gene Start:
175802

Gene Stop:
175107

Gene Length:
696

Molecular Weight*:
25527

pI*:
6.60

Net Charge*:
-1.35

EC:
5.3.1.6  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle Energy Metabolism; Carbon fixatio

Comment:


Blast Summary:  PSI-Blast Search
CPn0141 is similar to TP0616, a predicted
ribose-5-phosphate isomerase in T. pallidum.

CPn0141 is orthologously related to CT213, a predicted rpiA ribose 5-phosphate isomerase:
residues 10-228 are 56% similar to CT213.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0120
COG name: Ribose 5-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0120 is amtky--ce--h----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 53 to 225 (E-value = 2.8e-78) place CPn0141 in the Rib_5-P_isom_A family which is described as Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026)

PDB Hit:


Gene Protein Sequence:
VEKDLHLHEKKCLAHEAATQVTSGMILGLGSGSTAKEFIFALAHRIQTES
LAVHAIASSQNSYALAKQLAIPLLNPEKFSSLDLTVDGADEVDPQLRMIK
GGGGAIFREKILLRAAKRSIILVDESKLVPVLGKFRVPLEISRFGRSAII
EEIRHLGYEGEWRLQDTGDLFITDSSNYIYDIFSPNSYPNPEKDLLKLIQ
IHGVIEVGFVIEKVEVWSSNSQGLISKKYSV$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAAAGATCTTCATCTTCATGAGAAAAAATGCCTGGCCCATGAGGC
TGCTACACAAGTAACTTCAGGCATGATTCTTGGCTTAGGCAGTGGATCTA
CAGCTAAGGAATTTATCTTTGCACTCGCCCATAGAATTCAAACAGAGTCC
TTAGCAGTTCATGCTATAGCTTCTTCTCAAAATTCTTATGCTCTAGCAAA
GCAGCTTGCCATCCCCCTCTTAAACCCAGAAAAATTCTCTTCCCTAGATC
TTACGGTAGACGGTGCTGATGAAGTCGACCCTCAATTGCGGATGATCAAA
GGTGGTGGCGGAGCCATTTTCAGAGAAAAGATTCTTTTAAGAGCAGCAAA
ACGCAGCATTATCCTTGTTGATGAAAGTAAACTGGTTCCAGTCCTAGGAA
AATTTCGTGTTCCTTTAGAAATCAGTCGATTCGGTCGCTCAGCAATTATT
GAAGAAATCCGCCATCTTGGATATGAAGGAGAATGGCGCCTACAAGATAC
TGGTGACCTATTTATTACAGACAGCAGCAACTACATTTACGATATTTTTT
CCCCCAACTCCTACCCAAATCCTGAAAAGGATTTATTAAAGTTAATACAA
ATTCATGGTGTTATTGAAGTCGGGTTTGTTATAGAGAAAGTCGAAGTGTG
GTCTAGCAATAGCCAAGGTCTAATCAGCAAAAAATATTCTGTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy