Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR115 IGR113 IGR118 IGR114 IGR119 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 CPn0142 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0140

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yqdE  

Definition:
conserved hypothetical protein

Gene Start:
175110

Gene Stop:
174670

Gene Length:
441

Molecular Weight*:
16700

pI*:
4.70

Net Charge*:
-7.14

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0140 is orthologously related to CT212: residues 1-146 of CPn0140 are 59% similar to residues 1-148 of CT212, a conserved hypothetical protein (acidic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1259
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1259 is a----qvc--r-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 146 (E-value = 2.2e-86) place CPn0140 in the DUF151 family which is described as Uncharacterised ACR, COG1259 (PF02577)

PDB Hit:


Gene Protein Sequence:
MSLEKELLEETPLVLLNFYKLVSFCNYAGMILGTEEKKFAIYGHVSMGQA
FQGADTEGHSPQRPFAHDLLNFVFSGFDIQVLRVVINDYKDNVFYTRLFL
EQKDREFLYVVDVDARPSDSIPLALTHKIPILCVKSVFDAVVPYEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTTAGAAAAAGAACTCCTAGAAGAAACCCCCTTAGTACTTCTCAA
TTTTTACAAACTTGTCAGTTTTTGTAATTATGCAGGCATGATCTTAGGTA
CTGAAGAAAAAAAGTTCGCTATATATGGGCACGTTTCCATGGGGCAAGCA
TTTCAAGGTGCTGATACTGAAGGACACTCTCCTCAAAGACCTTTTGCTCA
TGATCTACTGAACTTTGTCTTTTCAGGTTTCGATATCCAAGTGTTACGTG
TAGTAATTAATGACTATAAAGATAACGTTTTCTACACAAGACTCTTTTTA
GAACAAAAAGATCGCGAATTTCTATACGTCGTTGATGTCGATGCCCGTCC
TAGCGATAGCATCCCTCTCGCCTTAACTCATAAAATCCCCATCTTGTGTG
TTAAATCAGTATTTGATGCTGTAGTCCCCTACGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy