Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR115 IGR113 IGR112 IGR118 IGR114 IGR119 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 clpB, - CPn0144 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0139

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yqgE  

Definition:
conserved hypothetical protein

Gene Start:
174656

Gene Stop:
174090

Gene Length:
567

Molecular Weight*:
20802

pI*:
4.30

Net Charge*:
-11.51

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0139 is orthologously related to CT211: residues 2-188 of CPn0139 are 58% similar to residues 3-189 of CT211, a conserved hypothetical protein (acidic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1678
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1678 is --------e-rh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 186 (E-value = 6.5e-80) place CPn0139 in the DUF179 family which is described as Uncharacterized ACR, COG1678 (PF02622)

PDB Hit:


Gene Protein Sequence:
MKIPYARLEKGSLLVASPDINQGVFARSVILLCEHSLNGSFGLILNKTLG
FEISDDIFTFEKVSNHNIRFCMGGPLQANQMMLLHSCSEIPEQTLEICPS
VYLGGDLPFLQEIASSESGPEINLCFGYSGWQAGQLEKEFLSNDWFLAPG
NKDYVFYSEPEDLWALVLKDLGGKYASLSTVPDNLLLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTCCTTATGCACGCCTAGAAAAAGGATCTTTGTTAGTCGCTTC
TCCTGATATAAACCAAGGAGTCTTTGCTCGTAGTGTCATCCTACTTTGTG
AACATAGCCTCAATGGTTCTTTCGGTCTCATCTTAAATAAAACCCTGGGA
TTTGAAATCTCAGATGACATCTTTACCTTTGAAAAAGTCTCCAATCATAA
TATCCGCTTTTGTATGGGAGGCCCCCTACAAGCAAACCAAATGATGTTAC
TTCATTCATGCTCCGAAATTCCTGAACAAACGTTAGAAATTTGTCCATCA
GTCTACTTAGGAGGAGATCTTCCCTTCCTCCAAGAAATCGCCTCTAGCGA
ATCTGGGCCAGAAATCAACCTATGTTTTGGCTATAGCGGATGGCAAGCAG
GACAACTTGAAAAAGAATTCCTAAGCAATGACTGGTTTCTAGCTCCAGGG
AACAAAGACTACGTCTTTTACTCAGAACCAGAAGATCTCTGGGCTTTAGT
TCTTAAAGATCTTGGAGGAAAATATGCCTCGCTTTCTACAGTCCCTGACA
ATCTATTGCTAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy