Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR111 IGR115 IGR113 IGR112 IGR118 IGR114 IGR119 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 clpB, - CPn0144 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 clpB, - CPn0144 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142 clpB, - CPn0144
* Calculated from Protein Sequence

Gene ID: CPn0138

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemL  

Definition:
glutamate-1-semialdehyde 2,1-aminomutase

Gene Start:
174019

Gene Stop:
172697

Gene Length:
1323

Molecular Weight*:
47944

pI*:
5.50

Net Charge*:
-13.98

EC:
5.4.3.8  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Comment:
This enzyme is involved in the porphyrin biosynthesis via the C5 pathway;
it is pyridoxal phosphate dependent.

Blast Summary:  PSI-Blast Search
CPn0138 is orthologous to CT210, a predicted glutamate-1-semialdehyde 2,1-aminomutase:
residues 13-432 are 56% similar to CT210. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0001
COG name: Glutamate-1-semialdehyde aminotransferase
Functional Class:  H
The phylogenetic pattern of COG0001 is amt--q-ceBr-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0138 is weakly paralogous to CPn1041, a predicted Adenosylmethionine-8-Amino-7-Oxononanoate Aminotransferase:
residues 37-323 are 24% similar to CPn1041.

Pfam Summary:  Pfam Search
Residues 28 to 432 (E-value = 1.5e-59) place CPn0138 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

PDB Hit:


Gene Protein Sequence:
MLNCSNQKHTVTFEEACQVFPGGVNSPVRACRSVGVTPPIVSSAQGDIFL
DTHGREFIDFCGGWGALIHGHSHPKIVKAIQKTALKGTSYGLTSEEEILF
ATMLLSSLKLKEHKIRFVSSGTEATMTAVRLARGITNRSIIIKFIGGYHG
HADTLLGGISTTEETIDNLTSLIHTPSPHSLLISLPYNNSQILHHVMEAL
GPQVAGIIFEPICANMGIVLPKAEFLDDIIELCKRFGSLSIMDEVVTGFR
VAFQGAQDIFNLSPDITIYGKILGGGLPAAALVGHRSILDHLMPEGTIFQ
AGTMSGNFLAMATGHAAIQLCQSEGFYDHLSQLEALFYSPIEEEIRSQGF
PVSLVHQGTMFSLFFTESAPTNFDEAKNSDVEKFQTFYSEVFDNGVYLSP
SPLEANFISSAHTEENLTYAQNIIIDSLIKIFDSSAQRFF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAACTGCTCAAATCAAAAGCATACCGTTACTTTTGAAGAGGCATG
CCAAGTCTTCCCAGGAGGCGTGAACTCTCCCGTTCGGGCCTGCCGTTCTG
TAGGAGTCACACCCCCTATAGTGAGCTCAGCACAAGGAGATATTTTCCTA
GATACTCACGGACGAGAGTTTATTGATTTTTGTGGAGGCTGGGGAGCTTT
AATTCACGGCCACAGTCATCCCAAAATTGTCAAGGCTATCCAAAAAACAG
CTCTAAAAGGAACCTCCTATGGCTTAACCTCTGAAGAGGAAATTCTATTT
GCAACAATGCTCCTCTCCTCGCTCAAACTCAAAGAACATAAAATCCGTTT
TGTATCCTCGGGAACGGAAGCAACAATGACTGCAGTACGTCTCGCTCGAG
GAATCACAAACCGCTCTATTATTATCAAATTTATAGGGGGATATCACGGT
CATGCAGATACTCTTCTTGGAGGCATCTCAACAACTGAAGAAACTATAGA
CAACCTAACTTCATTGATACACACGCCCTCTCCACATTCTTTATTGATAT
CCCTGCCTTATAACAATAGCCAAATCCTACACCATGTCATGGAAGCTCTA
GGACCTCAAGTAGCAGGAATTATCTTTGAACCTATATGTGCAAATATGGG
TATCGTCCTTCCCAAAGCCGAATTTCTAGACGATATCATAGAACTCTGCA
AACGCTTCGGAAGTCTTTCTATTATGGATGAAGTCGTCACAGGATTTCGA
GTGGCATTCCAAGGAGCTCAAGATATTTTCAATCTCTCCCCCGATATTAC
CATCTATGGAAAAATCTTAGGAGGAGGCCTACCTGCTGCAGCCCTTGTAG
GACACCGCTCAATTCTCGATCACCTCATGCCCGAAGGCACCATATTCCAA
GCAGGTACCATGTCTGGGAACTTCCTCGCTATGGCTACAGGACACGCCGC
CATTCAATTATGCCAATCCGAAGGATTCTATGACCATCTCAGCCAATTAG
AGGCTCTCTTTTATTCTCCAATTGAAGAGGAAATCCGATCTCAAGGATTC
CCAGTATCTCTAGTACATCAGGGAACGATGTTCAGCCTCTTTTTTACAGA
ATCTGCACCCACAAATTTTGATGAAGCAAAAAATTCCGATGTAGAGAAAT
TTCAAACCTTCTACTCTGAAGTATTTGATAATGGAGTCTACCTTTCTCCA
TCTCCCCTCGAAGCAAACTTCATTAGCTCCGCACATACCGAAGAAAACCT
AACTTACGCACAGAACATCATTATCGATAGCCTGATTAAAATCTTTGACT
CTTCGGCTCAAAGATTTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy