Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR117 IGR116 IGR111 IGR115 IGR113 IGR112 IGR118 IGR110 IGR114 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0133 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 CPn0142 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0133 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0133 CPn0143 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 yqdE, - CPn0140 yqdE, - CPn0140 CPn0142
* Calculated from Protein Sequence

Gene ID: CPn0137

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ybgI  

Definition:
conserved hypothetical protein; ACR family

Gene Start:
172254

Gene Stop:
171499

Gene Length:
756

Molecular Weight*:
27221

pI*:
6.00

Net Charge*:
-5.65

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0137 is orthologously related to CT108: residues 1-251 of CPn0137 are 66% similar to residues 1-251 of CT108, a predicted conserved hypothetical protein (YbgI ACR family) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0327
COG name: Uncharacterized ACR, YbgI/Acr family
Functional Class:  S
The phylogenetic pattern of COG0327 is amtky---ebrhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 10 to 247 (E-value = 1.3e-98) place CPn0137 in the NIF3 family which is described as NIF3 (NGG1p interacting factor 3) (PF01784)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
126  
192

PDB Hit:


Gene Protein Sequence:
MNVADLLSHLETLLSSKIFQDYGPNGLQVGDPQTPVKKIAVAVTADLETI
KQAVAAEANVLIVHHGIFWKGMPYPITGMIHKRIQLLIEHNIQLIAYHLP
LDAHPTLGNNWRVALDLNWHDLKPFGSSLPYLGVQGSFSPIDIDSFIDLL
SQYYQAPLKGSALGGPSRVSSAALISGGAYRELSSAATSQVDCFITGNFD
EPAWSTALESNINFLAFGHTATEKVGPKSLAEHLKSEFPISTTFIDTANP
F$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGTTGCGGATCTCCTTTCTCATCTTGAGACTCTTCTCTCATCAAA
AATATTTCAGGATTATGGACCCAACGGACTTCAAGTTGGAGATCCCCAAA
CTCCGGTAAAGAAAATCGCTGTTGCAGTTACCGCAGATCTAGAAACCATA
AAACAAGCTGTTGCGGCCGAAGCAAACGTTCTCATTGTACACCACGGAAT
TTTTTGGAAAGGTATGCCCTATCCTATTACCGGCATGATCCATAAGCGCA
TCCAATTACTAATAGAACACAATATCCAACTCATTGCCTACCACCTTCCT
TTGGATGCTCACCCTACCTTAGGAAATAACTGGAGAGTTGCCCTGGATCT
AAATTGGCATGACTTGAAGCCCTTTGGTTCTTCCCTCCCTTATTTAGGAG
TGCAAGGCTCTTTCTCTCCTATCGATATAGATTCTTTCATTGACCTGTTA
TCTCAATATTACCAAGCTCCCCTAAAAGGATCTGCCTTGGGCGGCCCCTC
TAGAGTCTCCTCAGCAGCTCTGATCTCAGGAGGAGCTTATAGAGAACTCT
CTTCGGCAGCCACGTCCCAAGTCGATTGCTTCATCACAGGAAATTTTGAT
GAACCTGCATGGTCGACAGCTCTAGAAAGCAATATCAACTTCCTAGCATT
TGGACATACAGCCACAGAAAAAGTAGGTCCAAAATCTCTTGCAGAGCATC
TAAAAAGCGAATTTCCTATTTCCACAACCTTTATAGATACGGCCAACCCC
TTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy