Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR109 IGR116 IGR111 IGR115 IGR113 IGR112 IGR110 IGR114 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0133 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 CPn0132 CPn0131 groES, - CPn0135 yqgE, - CPn0139 rpiA, - CPn0141 ybgI, - CPn0137 CPn0133 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 CPn0132 CPn0131 groES, - CPn0135 yqgE, - CPn0139 ybgI, - CPn0137 CPn0133 hemL, - CPn0138 groEL, - CPn0134 pepF, - CPn0136 yqdE, - CPn0140 rpiA, - CPn0141 yqdE, - CPn0140 CPn0131 CPn0132
* Calculated from Protein Sequence

Gene ID: CPn0136

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepF  

Definition:
oligoendopeptidase F (a metalloprotease)

Gene Start:
171401

Gene Stop:
169566

Gene Length:
1836

Molecular Weight*:
69857

pI*:
5.70

Net Charge*:
-13.61

EC:
 

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Secondary Evidence:
"BIOCHEMICAL AND GENETIC-CHARACTERIZATION OF PEPF, AN OLIGOPEPTIDASE FROM LACTOCOCCUS-LACTIS." 1994. MONNET V, NARDI M, CHOPIN A, CHOPIN MC, GRIPON JC. JOURNAL OF BIOLOGICAL CHEMISTRY 269(51): 32070-32076.

Comment:
Oligoendopeptidase F hydrolyzes peptides containing between 7 and 17 amino acids with a rather wide specificity.
Cofactor is zinc. It belongs to the peptidase family M3 (zinc metalloprotease); also known as the thimet oligopeptidase subfamily.


Blast Summary:  PSI-Blast Search
CPn0136 is orthologously related to CT112: residues 1-608 of CPn0136 are 62% similar to residues 1-608 of CT112, a predicted oligoendopeptidase (a metalloprotease) from C. trachomatis.
CPn0136 is also similar to UU065, UU521, MG183, all oligoendopeptidases.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1164
COG name: Oligoendopeptidase F
Functional Class:  E
The phylogenetic pattern of COG1164 is ------v--B--ujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 213 to 596 (E-value = 3.3e-163) place CPn0136 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
124  
213
non-globular  
537  
611

PDB Hit:


Gene Protein Sequence:
MTTELKTEALPTRTQVDPKHCWDTTLMYANREEWKKDFDLCSSGKDRSPI
WPEFSPSHYQIDNPESLLELLSKKFSVERKLDQLYIYAHLIHDQDITNPE
GESDYQSIVYLYTLFSQEISWIQPALIALSEEKVAALLSSSVLAPYRFYL
EKIFRLSPHTGTANEEKILASSFAALNVSNKAFSSLSDAEIPFGIAKDSN
GEEHPLSHALASLYMQSPDQELRRTAYLAQFQRYYDYRNTFANLLNGKVQ
AHLFEAKARNYPSCLEASLFQHNIPTTVYINLINETKKHTSLINRYFNLK
KEALNLKEFHFYDVYAPISQTTSKNYSYEEGVDLVCKSLLPLGTHYVEIL
RNGLLSNRWVDRYENKHKRSGAYSSGCYDSAPYILLNYTNTLYDVSVIAH
EAGHSMHSYFSREAQPYHDAQYPLFLAEIASTFNEMLLMEALSKSDQSKE
DKIVIITKTLDTIFATLFRQTFFAAFEYEIHSAAEQGTPLTEEFLSATYG
NLQKEFYGGVVTSDSLSALEWARIPHFYYNFYVYQYATGIIAALSFAEKI
LTQEPGALELYLKFLKSGRSDFPLNILKKSGLDMTTSAPLDKAFAFITKK
IDLLSSLLSED$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTACTGAACTGAAAACCGAAGCACTCCCAACAAGAACTCAAGTAGA
TCCAAAGCATTGTTGGGACACAACTCTCATGTACGCAAATAGAGAGGAGT
GGAAAAAAGATTTCGATCTTTGTAGCTCTGGAAAAGATCGTTCTCCCATA
TGGCCCGAATTCTCTCCCTCTCATTATCAAATCGATAACCCCGAATCTTT
ACTCGAACTTTTATCAAAAAAATTCTCTGTAGAACGAAAATTAGACCAAC
TCTACATATACGCTCACCTCATCCACGATCAAGATATTACAAATCCCGAA
GGGGAAAGCGACTACCAATCCATTGTCTATCTCTACACTCTCTTTTCTCA
GGAAATTTCTTGGATCCAACCAGCTTTAATTGCTCTTTCTGAAGAAAAAG
TCGCTGCCTTGCTATCCAGCTCAGTGCTCGCTCCCTATAGATTTTACCTA
GAAAAAATTTTCCGTCTTTCTCCCCACACAGGAACAGCAAACGAAGAAAA
GATCTTAGCCTCCTCGTTTGCAGCCCTTAATGTCTCAAATAAAGCTTTCT
CTTCCTTAAGCGATGCAGAAATTCCTTTTGGTATAGCTAAAGATTCGAAC
GGAGAAGAACATCCGCTATCCCATGCCCTGGCTTCGCTGTATATGCAATC
CCCAGATCAGGAATTGCGCCGTACTGCCTACTTAGCTCAATTCCAACGTT
ACTATGATTACCGTAACACCTTCGCGAATCTTCTCAATGGGAAAGTCCAA
GCGCATCTCTTTGAAGCCAAAGCAAGAAATTACCCTTCGTGCCTAGAGGC
ATCCCTATTCCAACATAACATCCCTACAACTGTTTATATCAATCTTATAA
ACGAAACAAAGAAACACACTTCTCTTATCAATCGGTATTTTAACCTAAAA
AAAGAAGCTCTAAATCTAAAAGAATTCCACTTTTATGATGTTTATGCTCC
TATTTCCCAAACTACAAGTAAGAATTATAGTTATGAAGAAGGCGTTGACC
TAGTTTGCAAAAGCCTCCTTCCCTTAGGGACTCATTATGTTGAAATTCTA
AGAAATGGTCTTCTTTCAAATCGTTGGGTAGACAGATACGAAAATAAGCA
CAAGCGTTCGGGAGCCTACTCCTCAGGATGCTATGATAGCGCTCCTTATA
TTCTTCTAAACTACACGAATACACTCTATGACGTTTCCGTCATTGCCCAT
GAAGCTGGACATAGCATGCACTCCTACTTCAGTAGAGAAGCACAGCCCTA
TCATGATGCCCAATACCCTCTGTTTCTTGCTGAAATTGCCTCAACATTCA
ATGAGATGCTCCTCATGGAAGCTCTCAGCAAATCAGATCAAAGTAAAGAA
GACAAAATCGTAATTATCACTAAAACTCTAGACACCATATTTGCGACTCT
GTTCCGTCAAACCTTTTTCGCTGCCTTCGAATACGAAATTCATTCTGCAG
CAGAACAAGGAACTCCTCTTACTGAAGAGTTCCTCTCCGCAACTTACGGT
AATTTACAAAAAGAATTCTACGGAGGTGTTGTAACCTCGGATTCCCTATC
TGCATTAGAATGGGCTAGAATCCCTCACTTCTACTATAATTTCTATGTTT
ATCAATATGCGACAGGTATCATAGCTGCCCTCTCCTTTGCTGAAAAAATT
CTTACACAAGAACCAGGGGCTCTCGAACTTTATTTAAAATTTTTGAAAAG
CGGAAGGTCTGACTTCCCACTCAATATATTAAAGAAATCGGGATTGGATA
TGACCACCTCTGCTCCATTAGATAAAGCCTTTGCATTCATTACGAAAAAG
ATAGACCTACTCTCTTCCTTGCTTTCAGAAGATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy