Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR107 IGR111 IGR113 IGR112 IGR110 IGR105 IGR108 groES, - CPn0135 CPn0130 CPn0129 ybgI, - CPn0137 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 bpl, - CPn0128 CPn0132 CPn0131 groES, - CPn0135 CPn0130 CPn0129 ybgI, - CPn0137 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 bpl, - CPn0128 CPn0132 CPn0131 groES, - CPn0135 CPn0129 ybgI, - CPn0137 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 CPn0130 bpl, - CPn0128 CPn0132 CPn0131
* Calculated from Protein Sequence

Gene ID: CPn0133

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
167334

Gene Stop:
166561

Gene Length:
774

Molecular Weight*:
29739

pI*:
9.30

Net Charge*:
8.18

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0133 is orthologously related to CT109, a conserved hypothetical protein: residues 1-256
are 48% similar to CT109.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
147  
257

PDB Hit:


Gene Protein Sequence:
MFKLLKNLFLIGCCIVGYFWMRKESIVEQWLSNRLHTQVTVGRVSIRTSG
IKIRHICIHNPLASERFPYAAEIEYADVRFSSISMLLTKQLEISELIIHG
ANFTIFPYDSHGTKTNWSLVWKNFHPQKETPSNLWIDRAPVLIRRCLFLN
TRLYGLRANHKDIPHLSVPSLEFHSHTSSAKELPKLSEALPSLLYLALEE
SLYHLNLPGDIIKPLSQQAHKHFYSSYPQFQDRLNDINTPGTPTEEIIGF
IRGLFFH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAACTGCTAAAAAATCTATTTCTTATAGGGTGCTGCATCGTTGG
ATATTTCTGGATGCGCAAAGAAAGTATCGTTGAGCAATGGCTATCTAACC
GCCTCCACACCCAAGTCACTGTAGGAAGAGTCTCCATAAGAACTTCTGGA
ATTAAAATCCGTCATATCTGCATTCATAACCCTCTAGCTTCTGAACGCTT
TCCTTACGCCGCCGAAATCGAGTACGCAGATGTACGATTTTCTTCCATAT
CTATGCTACTAACGAAACAGTTGGAAATCTCCGAGCTCATTATCCATGGG
GCAAACTTCACCATATTCCCCTACGACAGTCACGGCACAAAAACAAACTG
GTCTTTAGTATGGAAAAACTTCCATCCACAAAAAGAAACCCCCTCAAACT
TATGGATAGACCGTGCTCCTGTGCTCATCCGAAGATGCCTATTTCTAAAC
ACACGGTTGTACGGACTCAGAGCTAACCATAAAGACATTCCCCATCTTTC
TGTGCCATCCTTGGAATTCCATAGCCATACTAGCTCAGCTAAAGAATTAC
CAAAACTCTCAGAGGCTCTCCCTTCCTTGCTCTACCTAGCTCTAGAAGAA
AGCCTCTACCACCTGAACCTCCCTGGAGATATTATTAAACCCCTATCCCA
ACAAGCTCATAAACACTTCTACTCATCGTATCCACAATTCCAAGACCGTC
TTAACGATATCAATACCCCTGGAACACCTACAGAAGAAATCATAGGCTTC
ATCCGAGGACTCTTCTTTCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy