Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR107 IGR104 IGR111 IGR112 IGR110 IGR105 IGR108 groES, - CPn0135 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 groES, - CPn0135 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 groES, - CPn0135 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 pepF, - CPn0136 CPn0130 bpl, - CPn0128 CPn0132 CPn0131 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0132

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
165587

Gene Stop:
166564

Gene Length:
978

Molecular Weight*:
37296

pI*:
6.50

Net Charge*:
-2.06

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
57
transmembrane  
62  
83
non-globular  
159  
249

PDB Hit:


Gene Protein Sequence:
MIEFAFVPHTSVTADRIEDRMACRMNKLSTLAITSLCVLISSVCIMIGIL
CISGTVGTYAFVVGIIFSVLALVACVFFLYFFYFSSEEFKCASSQEFRFL
PIPAVVSALRSYEYISQDAINDVIKDTMQLSTLSSLLDPEAFFLEFPYFN
SLIVNHSMKEADRLSREAFLILLGEITWKDCETKILPWLKDPNITPDDFW
KLLKDHFDLKDFKKRIATWIRKAYPEIRLPKKHCLDKSIYKGCCKFLLLS
ENDVQYQRLLHKVCYFSGEFPAMVLGLGSEVPMVLGLPKVPKDLTWEMFM
ENMPVLLQSKREGHWKISLEDVASL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCGAGTTTGCTTTTGTTCCTCATACCTCCGTGACAGCGGATCGGAT
TGAGGATCGCATGGCCTGTCGCATGAACAAGTTGTCTACTTTAGCAATTA
CAAGTCTTTGTGTATTGATCAGTTCAGTTTGTATTATGATTGGGATTTTA
TGCATTTCTGGAACGGTTGGGACCTATGCATTTGTTGTAGGAATTATTTT
TTCTGTGCTTGCTTTGGTAGCATGTGTTTTCTTTCTTTATTTCTTTTATT
TTTCTTCTGAGGAATTTAAGTGTGCTTCTTCGCAGGAGTTTCGTTTTTTG
CCTATACCAGCTGTGGTTTCTGCATTGCGTTCCTATGAATACATTTCTCA
GGACGCTATCAATGACGTTATAAAAGATACGATGCAGTTGTCTACCCTTT
CTTCTCTTTTAGATCCCGAAGCTTTTTTCTTAGAATTTCCTTATTTTAAC
TCTTTGATAGTGAATCATTCGATGAAGGAAGCGGATCGTTTGTCTCGAGA
GGCTTTTTTGATTTTATTAGGTGAGATTACTTGGAAGGATTGTGAAACAA
AAATTTTGCCATGGTTGAAAGATCCTAATATCACTCCTGATGATTTCTGG
AAGCTATTAAAAGACCATTTCGATTTAAAGGACTTTAAGAAGAGGATCGC
CACTTGGATACGGAAGGCCTATCCAGAAATTAGATTACCGAAGAAGCATT
GTTTAGATAAGTCTATCTATAAGGGGTGTTGTAAGTTTTTATTACTTTCT
GAGAATGATGTGCAATATCAGAGGTTATTACATAAGGTCTGTTATTTCTC
TGGGGAGTTTCCTGCCATGGTTTTAGGTTTGGGAAGTGAAGTGCCTATGG
TGTTAGGACTCCCTAAGGTTCCCAAGGATCTTACCTGGGAGATGTTTATG
GAAAATATGCCTGTTCTTCTGCAAAGCAAAAGAGAGGGGCATTGGAAAAT
CTCCTTGGAAGACGTAGCCTCTCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy