Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR107 IGR104 IGR110 IGR105 IGR108 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0130 bpl, - CPn0128 CPn0132 CPn0131 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0130

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
164245

Gene Stop:
163748

Gene Length:
498

Molecular Weight*:
18238

pI*:
9.20

Net Charge*:
4.09

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. No similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
29  
53
transmembrane  
58  
75
non-globular  
86  
165

PDB Hit:


Gene Protein Sequence:
MVKCSSIIHENKKPAQLLPESKFAAITKLSLAILSLFLGIAACILIALSG
LLPNTLLIIALSLISIIVLSTGISLLIGTQCSKSVQKDEQKPKSIFPKET
PSLDPWLLNPLKNKIQSSETLLLDPTSINLKNELFFPSFEEWKKIFLKDP
DFLIKSALANWKILE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCAAGTGTTCTTCAATTATACACGAAAATAAAAAACCCGCTCAACT
GCTGCCAGAATCCAAATTCGCTGCTATAACGAAACTTTCTCTCGCCATAC
TTTCCCTATTCTTGGGGATTGCAGCATGCATACTCATAGCCCTCTCCGGA
CTTCTCCCAAATACTCTTTTGATAATAGCATTGTCCCTAATCAGTATAAT
CGTCCTAAGTACAGGAATCTCCCTGCTCATTGGAACACAGTGCTCGAAAA
GTGTTCAAAAGGACGAACAAAAACCAAAATCTATTTTTCCTAAAGAAACA
CCTTCTTTAGACCCCTGGCTCCTAAATCCTCTCAAAAATAAAATACAATC
CTCCGAAACACTACTCCTAGATCCAACATCCATAAACCTAAAAAATGAGC
TCTTTTTTCCATCCTTCGAAGAATGGAAAAAAATCTTTCTTAAAGATCCA
GATTTCCTAATTAAAAGTGCTCTCGCCAATTGGAAAATATTAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy