Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR107 IGR104 IGR110 IGR105 IGR103 IGR108 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0126 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0130 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0129

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
163717

Gene Stop:
163061

Gene Length:
657

Molecular Weight*:
25566

pI*:
4.80

Net Charge*:
-10.45

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0129 is weakly similar to CT036, a predicted hypothetical protein.
Residues 83-161 are 34% similar to CT036.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MDPRIFVTSEPLQKTYQKLQEKHVNNLGIASQVSLTDLQNKTQYENNLIE
TTTNEITYYFPVVHNPDILRSEWDPISNQLYLIFKKFFIHYHNLFSTALE
RNQILLIDSLNTGSSNPIARQMELLAFLCVFEQLDYNEDEYTIEPRDYFN
RFVYKNSQTAPQIQSFGLLHGYEEMSYASNNIRNVLTHSIVLCSPILYQL
ITEFDTTKIHADDFDCLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCCGAGAATCTTTGTCACCTCCGAACCTTTACAAAAAACCTATCA
AAAATTACAAGAAAAACATGTAAACAACTTAGGGATAGCCTCTCAAGTTT
CATTGACCGACTTGCAGAACAAAACGCAGTATGAAAATAACCTCATCGAA
ACCACAACAAATGAAATCACCTACTACTTCCCTGTAGTACATAATCCTGA
CATTCTAAGATCTGAATGGGATCCTATCTCGAACCAACTCTATCTAATTT
TCAAAAAATTCTTTATCCACTACCATAACCTATTTTCAACAGCATTAGAA
AGAAATCAAATACTACTCATAGATAGCCTTAACACAGGAAGCTCAAATCC
CATAGCAAGACAAATGGAACTACTCGCTTTTCTGTGTGTATTCGAGCAAT
TAGACTATAATGAAGATGAGTACACTATAGAACCTAGAGACTATTTCAAT
CGCTTTGTATATAAAAACAGCCAAACAGCTCCACAAATTCAATCGTTTGG
ACTACTCCACGGCTATGAAGAGATGTCTTATGCCTCCAATAACATCCGAA
ATGTCCTAACGCACTCCATAGTTCTTTGCAGCCCAATCCTATATCAGCTT
ATCACCGAGTTCGATACGACAAAAATACACGCTGATGATTTCGATTGCCT
AATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy