Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR102 IGR107 IGR104 IGR110 IGR105 IGR103 IGR108 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126 CPn0130 CPn0129 CPn0133 CPn0127 groEL, - CPn0134 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126 CPn0129 CPn0127 groEL, - CPn0134 CPn0130 CPn0133 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126 CPn0125
* Calculated from Protein Sequence

Gene ID: CPn0128

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bpl  

Definition:
biotin-protein ligase

Gene Start:
162277

Gene Stop:
163056

Gene Length:
780

Molecular Weight*:
29195

pI*:
9.00

Net Charge*:
6.92

EC:
6.3.4.-  6.3.4.10  6.3.4.11  6.3.4.15  6.3.4.9  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Biotin metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0128 is orthologously related to CT035: residues 5-249 of CPn0128 are 56% similar to residues 3-247 of CT035, a predicted biotin-protein ligase from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLRNQVLVYCSEGVSPYYLRHTIRFLKYYSTQEGAFDILRVDGNFLIKNP
FWEETTRLLVFPGGADRPYHRVLHGLGTARIFQYVSEGGNFLGICAGAYF
GSKMIYFYEPEGAPLQGARDLGFFPGTAKGPAYRGNFSYVSPSGVRVSPQ
LFSDFGLGYAMFNGGCFFEGSEGYPGVNIESRYDDLPGKPASIVSRIVSK
GLAVLSGPHIEYLPHYCRMVKENVQKTREFLQRERTTLDRYCQNLVQRLR
QPAFSKADC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAGGAATCAGGTACTTGTTTACTGTAGTGAGGGTGTTTCTCCTTA
TTATTTACGGCATACGATACGTTTTCTCAAGTACTATAGCACTCAAGAAG
GTGCTTTCGATATTCTTAGGGTCGACGGGAATTTTTTGATTAAGAATCCT
TTTTGGGAAGAAACGACGCGCTTATTGGTATTCCCAGGGGGTGCGGACCG
CCCCTATCATCGTGTACTTCATGGTTTAGGCACTGCCCGTATTTTCCAAT
ATGTTTCTGAGGGAGGGAATTTTCTAGGGATTTGTGCTGGGGCATATTTT
GGTTCTAAGATGATTTATTTTTATGAGCCTGAGGGAGCGCCGTTGCAAGG
GGCTCGAGATCTAGGGTTTTTCCCGGGGACTGCCAAAGGTCCTGCTTATA
GGGGGAATTTTTCTTATGTGAGTCCTTCTGGTGTAAGGGTTTCACCTCAG
TTATTTTCAGATTTTGGCTTGGGGTATGCGATGTTTAATGGGGGGTGTTT
TTTCGAGGGCTCGGAAGGATATCCTGGGGTGAATATCGAATCTCGGTATG
ACGATCTTCCAGGGAAGCCTGCGAGCATAGTGTCTAGGATTGTCAGTAAG
GGCTTAGCGGTTCTTTCAGGACCTCATATAGAGTATCTTCCTCATTACTG
TCGTATGGTTAAGGAGAACGTCCAGAAAACACGTGAATTCCTCCAAAGGG
AGCGTACAACTTTGGACCGCTATTGTCAGAATCTTGTACAGCGTTTGCGT
CAGCCTGCATTTTCGAAAGCGGACTGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy