Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR109 IGR106 IGR102 IGR107 IGR104 IGR105 IGR103 IGR108 CPn0130 CPn0129 CPn0133 CPn0127 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126 CPn0130 CPn0129 CPn0133 CPn0127 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126 CPn0129 CPn0133 CPn0127 CPn0130 CPn0125 bpl, - CPn0128 CPn0132 CPn0131 CPn0124 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0127

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible integral membrane protein)

Gene Start:
162143

Gene Stop:
161127

Gene Length:
1017

Molecular Weight*:
36926

pI*:
9.30

Net Charge*:
8.38

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0127 is similar to CT034, a conserved hypothetical protein (possible integral membrane protein):
residues 1-338 are 53% similar to CT034.
Residues 17-306 are 24% similar to YTFF_ECOLI.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0697
COG name: Predicted permeases
Functional Class:  R
The phylogenetic pattern of COG0697 is A-tKYQVCEB-Huj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 17-336 are 26% similar to a defined domain of YTFF_ECOLI, defined as: Hypothetical 35.5 kD protein in rplI-cpdB integenic region (F324). Hypothetical protein; transmembrane.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
39
transmembrane  
47  
64
transmembrane  
85  
109
transmembrane  
135  
153
transmembrane  
161  
181
transmembrane  
204  
224
transmembrane  
244  
261
transmembrane  
271  
290
transmembrane  
304  
321

PDB Hit:


Gene Protein Sequence:
MFPSANQESRTRNVPLGIFHGLVACLYWGIVFVIPNFLGSFGDLDIVLTR
YTIFGIFSLIACAIKNPSVIKKTPLYIWRKSLLWTLLINPVYYFGITLGI
RYVGSAITVVIASLAPTAVLYHSNTKQKELPYSLLFAISSVIITGVILTH
LSALNLPTAASPLYSILGVIAVILSTSLWVIYVIRNQSLLEKHPNLTPDT
WSYLIGISALIICLPMIIILDLCGITHVTHNLISHTPGSERLLFLLLCSA
MGIFSSAKALIAWNKASLNLSPALLGAILIFEPIFGLVLTYLYSQSLPSL
QEGIGIFLMLGGSLLCLVLFGRKVQKSLENSQVSSSNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCCCCAGCGCAAATCAAGAATCCAGAACCCGTAATGTACCCCTAGG
CATCTTCCATGGGCTCGTTGCCTGCCTATACTGGGGAATCGTCTTTGTCA
TACCAAACTTCCTCGGTTCGTTTGGCGATCTTGATATTGTACTTACCCGT
TATACCATTTTTGGTATTTTCTCCCTGATTGCTTGCGCTATAAAAAATCC
CTCCGTAATTAAAAAAACTCCTTTATATATTTGGAGAAAAAGCCTCCTCT
GGACACTGCTGATTAACCCCGTGTATTACTTCGGAATCACCCTTGGCATC
CGCTATGTTGGATCCGCAATCACTGTAGTCATCGCCAGCCTGGCTCCAAC
CGCCGTACTCTACCACTCCAATACAAAGCAAAAAGAACTCCCCTATTCTC
TACTCTTTGCTATCAGCAGTGTGATCATCACAGGAGTGATTCTGACACAC
CTCTCCGCACTCAACTTGCCAACAGCCGCCTCTCCTCTCTACTCTATCTT
GGGAGTCATTGCAGTCATACTCTCAACAAGTCTTTGGGTAATCTATGTGA
TCCGCAATCAATCGCTACTCGAAAAACACCCTAACCTAACTCCAGATACC
TGGAGCTACCTCATCGGAATCAGCGCTTTGATCATCTGCCTCCCTATGAT
TATTATTCTCGATCTCTGTGGAATTACCCACGTAACACACAATCTTATCT
CGCATACACCGGGATCCGAGCGACTGCTCTTCTTGTTGCTATGTAGTGCT
ATGGGAATATTTTCCTCAGCAAAAGCTTTAATAGCCTGGAATAAAGCTAG
TTTGAATCTCTCACCAGCATTGCTAGGGGCGATATTAATCTTTGAACCAA
TTTTTGGCCTTGTGCTTACCTATCTCTACTCACAAAGTCTTCCTTCTCTA
CAAGAAGGTATAGGAATCTTTCTAATGTTAGGAGGAAGCCTCCTCTGCCT
AGTTCTCTTCGGAAGAAAAGTACAGAAAAGTTTGGAAAACTCTCAAGTAT
CGTCTTCTAACGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy