Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Asn_1 IGR106 IGR102 IGR107 IGR104 IGR105 IGR103 IGR108 IGR101 CPn0130 CPn0129 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0131 CPn0124 CPn0126 CPn0130 CPn0129 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0131 CPn0124 CPn0126 CPn0129 CPn0127 recD, - CPn0123 CPn0130 CPn0125 bpl, - CPn0128 CPn0131 CPn0124 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0126

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
158809

Gene Stop:
161088

Gene Length:
2280

Molecular Weight*:
88850

pI*:
5.70

Net Charge*:
-12.44

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few weak hits in gapped BLAST to sequences outside of those in C.pneumoniae; e.g. residues 218-631 are 21% similar to (D45163) embryonic muscle myosin heavy chain [Halocynthia roretzi]; residues 229-635 are 23% similar to (U85023) slow myosin heavy chain 2 [Gallus gallus]; and residues 64-743 are 18% similar to MG218, a predicted adhesin accessory. No significant similarity to C.trachomatis, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous predicted hypothetical protein sequences in C.pneumoniae show significant paralogy. In order of similarity they are: CPn0007, CPn1054, CPn0012, CPn0043, CPn0045, CPn0124, CPn0009, CPn0041, CPn0010.1, CPn0042, CPn1055, CPn0010, and CPn1056.

Residues 1-715 are 25% similar to CPn0007.
Residues 9-754 are 23% similar to CPn1054.

Pfam Summary:  Pfam Search
Residues 3 to 223 (E-value = 1.2e-21) place CPn0126 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
29  
46
non-globular  
54  
87
coil-coil  
116  
147
coil-coil  
322  
381
coil-coil  
418  
462
coil-coil  
479  
529
coil-coil  
728  
759

PDB Hit:


Gene Protein Sequence:
LVFSYYCMGLFFFSGAISSCGLLVSLGVGLGLSVLGVLLLLLAGLLLFKI
QSMLREVPKAPDLLDLEDASERLRVKASRSLASLPKEISQLESYIRSAAN
DLNTIKTWPHKDQRLVETVSRKLERLAAAQNYMISELCEISEILEEEEHH
LILAQESLEWIGKSLFSTFLDMESFLNLSHLSEVRPYLAVNDPRLLEITE
ESWEVVSHFINVTSAFKKAQILFKNNEHSRMKKKLESVQELLETFIYKSL
KRSYRELGCLSEKMRIIHDNPLFPWVQDQQKYAHAKNEFGEIARCLEEFE
KTFFWLDEECAISYMDCWDFLNESIQNKKSRVDRDYISTKKIALKDRART
YAKVLLEENPTTEGKIDLQDAQRAFERQSQEFYTLEHTETKVRLEALQQC
FSDLREATNVRQVRFTNSENANDLKESFEKIDKERVRYQKEQRLYWETID
RNEQELREEIGESLRLQNRRKGYRAGYDAGRLKGLLRQWKKNLRDVEAHL
EDATMDFEHEVSKSELCSVRARLEVLEEELMDMSPKVADIEELLSYEERC
ILPIRENLERAYLQYNKCSEILSKAKFFFPEDEQLLVSEANLREVGAQLK
QVQGKCQERAQKFAIFEKHIQEQKSLIKEQVRSFDLAGVGFLKSELLSIA
CNLYIKAVVKESIPVDVPCMQLYYSYYEDNEAVVRNRLLNMTERYQNFKR
SLNSIQFNGDVLLRDPVYQPEGHETRLKERELQETTLSCKKLKVAQDRLS
ELESRLSRR$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTATTCTCATACTATTGCATGGGATTATTTTTTTTCTCTGGAGCTAT
TTCTAGTTGTGGTCTTTTAGTGTCTCTAGGAGTTGGTTTAGGACTTAGTG
TTTTAGGAGTACTTTTACTTCTCTTAGCAGGTCTTTTGCTTTTTAAGATC
CAAAGTATGCTTCGAGAGGTGCCTAAGGCTCCTGATCTATTAGATTTAGA
AGATGCAAGTGAACGGCTTAGAGTAAAGGCTAGCCGTTCTTTAGCAAGCC
TCCCGAAGGAAATCAGTCAGCTAGAGAGCTACATTCGTTCTGCAGCTAAT
GATCTAAATACAATTAAGACTTGGCCGCATAAAGATCAAAGACTCGTCGA
GACCGTGTCACGAAAATTAGAGCGTCTGGCAGCTGCTCAAAACTATATGA
TTTCTGAACTCTGCGAGATTAGTGAGATTCTTGAGGAAGAGGAGCATCAT
CTAATTTTGGCTCAGGAATCTCTAGAATGGATAGGTAAGAGTCTATTTTC
TACCTTTCTGGACATGGAATCTTTTTTAAATTTGAGCCATCTATCTGAAG
TGCGTCCGTACTTAGCTGTAAATGATCCTAGATTATTAGAAATTACCGAA
GAATCTTGGGAAGTAGTGAGTCATTTCATAAATGTAACGTCTGCTTTTAA
GAAAGCTCAGATTCTTTTTAAGAACAACGAACATTCTCGGATGAAGAAGA
AGTTAGAAAGTGTTCAAGAGTTACTGGAAACATTTATTTATAAGAGTTTA
AAGAGAAGTTATCGAGAATTAGGATGCTTAAGTGAAAAGATGAGAATCAT
TCACGACAATCCTCTCTTCCCTTGGGTGCAAGATCAGCAGAAGTATGCTC
ATGCTAAGAATGAATTTGGAGAGATTGCGCGGTGTTTAGAGGAGTTTGAA
AAGACGTTCTTCTGGTTGGATGAGGAGTGTGCTATTTCTTACATGGACTG
TTGGGATTTTCTAAATGAGTCTATTCAGAATAAGAAGTCCAGAGTAGATC
GAGATTATATATCCACGAAGAAAATTGCATTAAAGGATAGAGCCCGCACT
TATGCTAAGGTTCTTTTAGAAGAGAATCCGACTACAGAGGGTAAAATAGA
TTTGCAAGACGCTCAAAGAGCCTTTGAGCGTCAAAGTCAGGAGTTTTATA
CACTAGAGCATACGGAAACAAAGGTGAGACTAGAAGCACTTCAACAGTGC
TTCTCGGATCTTAGGGAGGCGACGAACGTAAGGCAAGTTAGGTTTACAAA
TTCTGAAAATGCGAATGATTTAAAGGAGAGTTTCGAGAAGATAGATAAAG
AGCGTGTGCGATATCAAAAAGAGCAAAGGCTCTATTGGGAAACAATAGAT
CGCAATGAGCAAGAGCTTAGGGAAGAGATTGGGGAGTCGCTTCGTTTACA
AAATCGGAGAAAAGGGTATAGGGCTGGATATGATGCTGGGCGTTTAAAAG
GTTTGTTGCGTCAGTGGAAGAAAAATCTCCGCGATGTGGAAGCCCACCTT
GAAGATGCAACTATGGATTTTGAGCATGAAGTAAGCAAGAGCGAATTGTG
CAGTGTTCGGGCGAGGCTCGAGGTTCTAGAAGAAGAGCTGATGGATATGT
CTCCTAAAGTTGCGGATATAGAAGAGTTGTTGTCCTATGAAGAGCGTTGT
ATTCTTCCTATTAGGGAAAATTTAGAAAGGGCATACCTCCAATATAATAA
GTGTTCTGAAATTTTATCCAAGGCAAAGTTCTTCTTTCCGGAAGACGAGC
AATTGCTAGTTTCGGAAGCGAATCTAAGAGAGGTGGGTGCCCAGTTAAAA
CAAGTACAGGGAAAATGTCAAGAGAGGGCCCAAAAGTTCGCAATATTTGA
AAAGCATATTCAGGAGCAGAAAAGCCTTATTAAAGAGCAAGTGCGGAGTT
TTGATCTAGCGGGAGTTGGGTTTTTAAAGAGTGAGCTTCTTAGTATTGCT
TGTAACCTTTATATAAAGGCGGTTGTTAAGGAGTCTATACCAGTTGATGT
GCCTTGTATGCAGTTATATTATAGTTATTACGAAGATAATGAAGCTGTAG
TGCGAAACCGCCTTTTAAATATGACGGAGAGGTATCAAAATTTTAAAAGG
AGTTTGAATTCCATACAATTTAATGGTGACGTTCTTTTACGGGATCCGGT
CTATCAACCTGAAGGTCATGAGACCAGGCTAAAGGAACGGGAGCTACAAG
AAACAACTTTGTCTTGTAAGAAATTAAAAGTGGCTCAAGATCGTCTTTCT
GAATTAGAGTCAAGGCTGTCTAGGAGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy