Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR106 IGR102 IGR104 IGR100 IGR105 IGR103 IGR101 CPn0129 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126 CPn0129 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126 CPn0129 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0125

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
158096

Gene Stop:
158608

Gene Length:
513

Molecular Weight*:
20372

pI*:
4.70

Net Charge*:
-9.68

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae. BLAST reveals no significant similarity to C.trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several weak, but significant hits to hypothetical protein sequences in C.pneumoniae, which in order of similarity are: CPn0126, CPn0012, CPn0007, CPn0042, CPn1056, CPn0046, and CPn0009.

Residues 1-169 are 24% similar to CPn0126.
Residues 20-166 are 21% similar to CPn0012.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
14  
81

PDB Hit:


Gene Protein Sequence:
MSEVKPLFLKNDSFDLATQRFQNLINMLQEQAEIYNEYEEKNARVQNEIK
EQKDFVKRCIEDFEARGLGVLKEELASLTRDFHDKAKAETSMLIECPCIG
FYYSIHQEEQRQRQERLQKMAERYRDCKQVLEAVQVEQKDMISSRVVVDD
SYFEEEKEEQKVDNRKKEQD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGAAGTGAAGCCTTTGTTTTTAAAGAATGACTCTTTTGATTTGGC
AACTCAGAGATTCCAGAATCTAATTAACATGCTACAAGAGCAAGCCGAGA
TATATAACGAGTATGAAGAAAAGAATGCTAGGGTTCAGAATGAGATTAAG
GAGCAAAAGGACTTTGTGAAAAGATGCATAGAGGACTTTGAAGCCAGAGG
ACTGGGGGTGCTAAAAGAAGAGCTTGCATCTTTGACGCGTGATTTCCATG
ATAAAGCAAAAGCAGAGACTTCTATGCTCATTGAATGTCCTTGTATTGGT
TTTTATTATAGTATTCATCAGGAGGAACAAAGGCAAAGGCAAGAAAGGCT
TCAAAAGATGGCTGAGCGCTATAGGGACTGTAAACAAGTCTTGGAGGCTG
TCCAGGTGGAGCAAAAAGATATGATATCTTCTAGAGTCGTTGTCGATGAC
AGCTACTTTGAAGAAGAAAAAGAAGAACAAAAGGTGGATAACAGAAAGAA
AGAACAGGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy