Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR102 IGR104 IGR100 IGR105 IGR103 IGR101 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126 CPn0127 recD, - CPn0123 CPn0125 bpl, - CPn0128 CPn0124 metG, - CPn0122 CPn0126
* Calculated from Protein Sequence

Gene ID: CPn0124

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
156614

Gene Stop:
158071

Gene Length:
1458

Molecular Weight*:
55862

pI*:
4.80

Net Charge*:
-20.95

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
This is a C. pneumoniae-specific hypothetical protein with no similarities to known genes from any other organisms.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1196
COG name: Chromosome segregation ATPases
Functional Class:  D
The phylogenetic pattern of COG1196 is am-kYqvc-br---gpol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0124 is similar to CPn0126, CPn1054, CPn0007, CPn0011, CPn0045, CPn0043, CPn0010, CPn1055, CPn0041, CPn0008, CPn0009, CPn0012 and CPn0010, all hypothetical proteins.

Pfam Summary:  Pfam Search
Residues 4 to 206 (E-value = 8.6e-100) place CPn0124 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
4  
23
transmembrane  
29  
47
coil-coil  
100  
127
coil-coil  
353  
384
coil-coil  
421  
456

PDB Hit:


Gene Protein Sequence:
VLGILLIASGIIFLAVAIPGLSSAVALGLGCGMTALGTVLLITGLVLLIR
SEKLALEQVEIKQARTRVNNELDQLSQYVFYTENVLDNLKRWSYRDLGFV
RQAQEEVTNLEQDIEEIFLTLRDIRNALDNEEFFMTHAKQCLAQVGESLF
QDASIDEFINLAHLSEIRQHLDINDPRWSMITKKVKGTVVRFIYVSTMYK
QIKSNFEKSDFGQLRKMLLNNYKTIEEVLYQSFQKGYNRAALLSEKTRII
HTSSLLHWEKDEDKHLNIKNECASRLENFKKFRTLFLGLSEEDVIDFTGA
SGWDCSKLPRKEVPLDGGKKKLRFKRTFADEQVGDWDRTTSLEHMTPQEE
DPLDRLMDQVEQEATSVLKDQDRYWKEIETSEAKFRSLPREDDFEKQSQI
DSYIRDLDDHLSVWANQLSAAEDALIEVTDVQEHGNREMLKNIQQGLELI
EDAVKATLPRVDFIQELLEKEELPLVAARMSLENS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTGGCATTCTTTTGATTGCTTCTGGGATTATTTTTCTAGCTGTCGC
TATTCCTGGATTGAGTTCAGCAGTTGCCTTAGGATTGGGCTGTGGTATGA
CTGCTTTAGGAACTGTTTTGTTGATTACAGGACTTGTCTTGCTGATCAGG
AGTGAGAAGCTCGCTCTAGAACAAGTAGAAATAAAGCAAGCTAGGACCAG
GGTGAATAATGAGTTAGATCAACTCAGTCAGTATGTTTTCTACACAGAAA
ATGTTTTAGATAATTTGAAGCGTTGGTCGTATCGAGATTTAGGTTTTGTG
AGACAGGCGCAAGAGGAGGTTACAAATTTAGAGCAAGACATTGAAGAAAT
TTTCTTGACGTTGCGAGATATTAGAAATGCTCTTGATAACGAAGAGTTTT
TTATGACTCATGCGAAACAGTGTTTAGCCCAAGTCGGAGAAAGCTTATTT
CAGGATGCTAGTATAGATGAGTTTATTAATTTGGCTCATCTATCCGAAAT
ACGTCAGCATTTGGATATCAATGATCCGAGATGGTCTATGATTACAAAGA
AAGTTAAAGGCACTGTGGTTCGGTTTATCTATGTCTCTACAATGTATAAA
CAAATAAAATCTAATTTTGAAAAAAGTGACTTCGGACAACTTAGGAAGAT
GCTACTGAACAATTACAAAACAATAGAAGAGGTCTTGTATCAGAGTTTTC
AAAAGGGCTACAATAGAGCCGCTTTGTTGAGTGAAAAGACAAGAATTATT
CATACGAGTTCTCTTTTGCATTGGGAAAAGGACGAAGATAAGCATCTTAA
TATTAAGAACGAGTGTGCAAGTCGTCTTGAGAATTTCAAGAAGTTTAGAA
CACTATTTCTTGGATTATCAGAGGAAGACGTTATTGACTTTACTGGAGCG
TCTGGTTGGGATTGTTCCAAACTGCCTCGGAAAGAGGTCCCGCTTGATGG
TGGCAAGAAGAAACTGAGGTTTAAAAGAACCTTTGCAGATGAACAAGTCG
GAGATTGGGATCGCACTACGTCTCTTGAGCATATGACACCTCAAGAGGAA
GATCCTTTAGACAGGTTAATGGATCAGGTTGAACAAGAGGCTACTTCAGT
CTTAAAAGATCAGGATCGTTATTGGAAAGAGATCGAGACAAGCGAAGCAA
AGTTTAGGTCCCTGCCACGGGAAGATGATTTTGAAAAGCAGTCACAGATT
GATAGTTATATTCGGGATTTGGACGACCATTTATCGGTTTGGGCGAATCA
GTTATCTGCTGCAGAAGATGCTTTGATAGAGGTTACAGATGTGCAGGAAC
ATGGAAATAGAGAAATGCTTAAGAATATACAACAGGGACTGGAGCTTATT
GAAGATGCTGTAAAAGCTACTCTACCTAGAGTTGACTTTATACAAGAGCT
TTTAGAGAAGGAAGAGCTTCCGTTGGTTGCTGCTAGGATGAGTTTAGAGA
ATAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy