Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR102 IGR98 IGR100 IGR99 IGR103 IGR101 recD, - CPn0123 CPn0121 rl19, - CPn0118 CPn0125 rnhB_1, - CPn0119 trmD, - CPn0117 CPn0124 metG, - CPn0122 CPn0126 recD, - CPn0123 CPn0121 rl19, - CPn0118 CPn0125 rnhB_1, - CPn0119 trmD, - CPn0117 CPn0124 metG, - CPn0122 CPn0126 recD, - CPn0123 CPn0125 rnhB_1, - CPn0119 trmD, - CPn0117 CPn0124 metG, - CPn0122 CPn0126 gmk, - CPn0120 CPn0121 rl19, - CPn0118 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0123

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recD  

Definition:
exodeoxyribonuclease V alpha subunit

Gene Start:
155969

Gene Stop:
153771

Gene Length:
2199

Molecular Weight*:
83430

pI*:
8.90

Net Charge*:
17.47

EC:
3.1.11.5  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0123 is orthologously related to CT033, a predicted recD exodeoxyribonuclease V alpha subunit:
residues 2-726 are 58% similar to CT033.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0507
COG name: ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member
Functional Class:  L
The phylogenetic pattern of COG0507 is -m--Y---ebrh----o-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0123 is weakly paralogous to CPn0752, a predicted
exodeoxyribonuclease V alpha subunit: residues
329-700 are 26% similar to 133-484 of CPn0752.

CPn0123 is orthologously related to CT033

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
207  
269

PDB Hit:


Gene Protein Sequence:
MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLELGSPI
QIYGVWSHSPSNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAE
KIIEKFQEKTCYVLDITPERLSEVSGISETRCVSICKQLCEQKILRKTLL
FLQEYNIPIHYGVRIFKKYQEKSIEKICEDPFLLAREMEGIGFKTADFIA
MKLGVPRNSESRLCAGIQHSLEELQEEGHTCYPIELLIDVVAKLLNQDVF
DTPITLEEIDTQILNMQKRKLLHIQDISGTLHVWTRYLHLAEKTIVSDLK
RILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKACFSEKLLIITG
GPGTGKSTITQAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIHA
LLQYDFKTKSFRKNHDNPIDCDLIIVDESGMMDTHLLHHFLKALPDYTTL
VFIGDIHQLPSVGPGNILKDLITSNKMTVIRLNKIFRQVHDSGIVTNAHR
VNEGELPILYSETGRRDFLFFQKDDQEEALNHIIHLVTKFVPQKYHIYPQ
DIQVLAPMKKGTLGIYNLNKALKHALNPKKANLHGRFQSYAVGDKVMQIR
NNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVGYSFSELDDLVLAYAT
SVHKYQGSESPCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILVGTKKAI
AIATRNNRVQHRCTGLAEVLKELDTKKNYADL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGAAAATCTGCGGATACTTAGAGCAAATACTTGTTGAAAACAAAGA
CTCTGGGGACATTACTGCTTATATCAAAATACCCAATAAAACGACTCCTA
TCCTAATTAAAGGCAAACTTCCCCAACCTTTGGAACTAGGATCCCCGATC
CAAATCTATGGTGTCTGGAGCCATTCCCCTTCAAATACTAAGTATTTCCA
AATCCATAGTTACGACTCTCCTCTTCTTTATGAATATCGTGGCGTATTCC
ATTACCTCACCTCAAAACTCATCAAAGGAATCGGCCCTAAAATCGCAGAA
AAGATCATCGAGAAATTTCAAGAGAAAACATGTTATGTCCTCGATATCAC
TCCAGAACGCTTAAGTGAGGTTTCTGGAATTAGCGAAACACGATGTGTCT
CTATTTGCAAACAACTCTGCGAGCAAAAAATCTTAAGGAAAACTCTTCTC
TTTCTCCAAGAATACAATATCCCGATTCATTATGGAGTGAGAATTTTTAA
AAAATACCAAGAGAAATCCATAGAAAAAATTTGCGAAGATCCCTTCCTTC
TAGCCAGAGAAATGGAGGGCATCGGATTCAAAACTGCTGATTTCATAGCT
ATGAAACTAGGCGTCCCCAGAAATTCTGAAAGTCGCCTATGTGCTGGTAT
CCAGCACTCCTTAGAAGAACTTCAAGAAGAAGGTCATACTTGCTATCCGA
TAGAGCTCCTGATAGATGTCGTCGCCAAACTATTAAATCAAGATGTCTTT
GATACTCCTATTACTCTCGAAGAAATCGATACGCAAATCCTCAATATGCA
AAAGCGTAAGCTTTTACATATTCAAGACATTTCTGGGACACTCCATGTCT
GGACACGTTATCTCCATCTCGCAGAGAAAACTATTGTTTCTGATCTCAAG
CGCATTTTATTTTCTTCGAGGAGAATCCGTTCTATAGACGGAGAAAAAGC
AATTGCTTGGGTAGAGGAAAACCTAAGTATAGATCTCGCAGAACAACAAC
GAGAAGCAATTAAAGCCTGTTTTTCTGAAAAACTTCTCATCATTACTGGG
GGCCCTGGAACTGGAAAAAGTACCATTACCCAAGCAATACTGAAAATTTT
TGAACAGGTGACTCATAAAATCATCCTCGCAGCTCCTACAGGAAAAGCCG
CTAAACGGATGACCGAAATTACACAAAAACACTCCGTCACCATTCATGCT
CTGCTACAGTATGATTTTAAAACGAAATCTTTCCGCAAGAACCATGACAA
TCCTATAGACTGTGATCTGATCATTGTTGACGAATCCGGAATGATGGACA
CGCACTTGCTGCACCACTTCCTGAAAGCACTTCCTGACTACACAACTCTT
GTCTTTATTGGAGACATTCACCAGCTACCCAGCGTGGGCCCAGGAAATAT
CCTTAAAGACTTGATTACTTCGAATAAAATGACAGTCATCAGATTAAATA
AGATCTTCCGCCAAGTTCATGATTCGGGAATCGTTACGAATGCCCATAGG
GTAAATGAAGGGGAACTCCCCATATTATATTCAGAAACAGGGCGTCGTGA
TTTCTTATTTTTCCAAAAGGATGATCAAGAAGAGGCTCTCAATCATATCA
TTCATCTTGTGACAAAATTCGTCCCACAAAAATACCATATCTATCCTCAA
GATATCCAAGTACTAGCTCCCATGAAAAAAGGAACCCTAGGAATCTATAA
TCTAAATAAAGCACTCAAACATGCATTAAACCCTAAAAAAGCAAATCTTC
ACGGTAGATTTCAATCCTATGCCGTTGGCGATAAGGTAATGCAAATCCGC
AACAACTATAATAAAGAAGTCTTTAACGGCGATATAGGCTATGTCTCTAC
AATCAACTTCGAAGATAAAGCTGTTGTTGTCCGTATGGAAGGAAAGCATG
TCGGCTATTCTTTCTCAGAGCTTGACGATCTAGTCTTAGCCTATGCTACC
TCAGTACATAAGTACCAGGGAAGTGAAAGCCCCTGCATTATCATTCCTAT
TCATACCTCGCACTTTATGATGCTCTATAGAAATCTTCTCTATACTGCTA
TTACGCGGGGGAAAAAATTGGTGATTCTAGTTGGGACAAAAAAAGCCATT
GCTATTGCAACAAGAAATAATCGAGTGCAACACCGATGTACAGGACTAGC
AGAAGTTCTTAAAGAGCTCGATACTAAGAAAAATTATGCAGATCTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy