Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR100 IGR99 IGR101 recD, - CPn0123 CPn0121 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 CPn0124 metG, - CPn0122 recD, - CPn0123 CPn0121 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 CPn0124 metG, - CPn0122 recD, - CPn0123 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 CPn0124 metG, - CPn0122 rs16, - CPn0116 gmk, - CPn0120 rs16, - CPn0116 CPn0121 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0121

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
151778

Gene Stop:
152071

Gene Length:
294

Molecular Weight*:
11081

pI*:
10.20

Net Charge*:
4.23

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0121 is orthologously related to CT031, a hypothetical protein and they share 65% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MIKKDRFTNEKLNKLFDSPFSLVNYAIKQAKIKIAKGDVRSSNVAIETLV
LLDREGIQPEFTEEIVVTASPTVERKRSEHTNSRKKDPSAYTWSDVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAAAAAGATCGTTTCACTAATGAAAAGTTAAATAAGCTTTTCGA
TAGTCCTTTTAGCCTAGTGAACTACGCGATTAAACAAGCAAAGATCAAAA
TTGCCAAAGGCGATGTTCGCTCCTCTAATGTTGCGATCGAAACACTCGTC
TTGTTAGATAGAGAAGGGATACAGCCTGAGTTTACTGAAGAGATTGTAGT
AACTGCTAGCCCTACTGTGGAAAGAAAGAGATCAGAACATACAAATTCTA
GAAAAAAAGATCCCTCAGCATATACTTGGAGTGATGTAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy