Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR100 IGR99 IGR101 recD, - CPn0123 CPn0121 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 recD, - CPn0123 CPn0121 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 recD, - CPn0123 rl19, - CPn0118 rnhB_1, - CPn0119 hemK,yfcB, - CPn0114 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 rs16, - CPn0116 gmk, - CPn0120 rs16, - CPn0116 CPn0121 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0120

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gmk  

Definition:
guanylate kinase

Gene Start:
151164

Gene Stop:
151781

Gene Length:
618

Molecular Weight*:
23352

pI*:
6.00

Net Charge*:
-3.69

EC:
2.7.4.8  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Gentry D, Bengra C, Ikehara K, Cashel M. 1993. Guanylate kinase of Escherichia coli K-12. J Biol Chem 268(19):14316-21.

Comment:
This protein is identical to GenBank accession AAD18273 (genome position accession AE001598). In prokaryotes(such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids.


Blast Summary:  PSI-Blast Search
CPn0120 is orthologously related to CT030, a predicted guanylate kinase: residues 4-202 are 62% similar to CT030. CPn0120 is also similar to MG107 and UU213. No similarity to T. pallidum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0194
COG name: Guanylate kinase
Functional Class: F
The phylogenetic pattern of COG0194 is ----yqvcEbrhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 55 to 158 (E-value = 4.4e-30) place CPn0120 in the Guanylate_kin family which is described as Guanylate kinase (PF00625)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
153  
195

PDB Hit:


Gene Protein Sequence:
MNKILVDSPFSPDHQKCCPKLFTISAPAGVGKTTLVRMLEQEFSSAFAET
ISVTTRKPREGEVPGKDYHFVSHEEFQRLLDRQALLEWVFLFGECYGTSM
LEIERIWSLGKHAVAVIDIQGALFIRSRMPSVSIFIAPPSQEELERRLAS
RGSEEGSQRKERLEHSLIELAAANQFDYVIINDDLNQAYRVLKSIFIAEE
HRNIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAGATCCTAGTTGACTCTCCTTTTTCTCCAGATCACCAGAAGTG
CTGTCCTAAGCTTTTTACAATTAGTGCTCCTGCTGGAGTTGGAAAGACAA
CACTTGTCCGTATGTTAGAGCAAGAGTTTTCTTCTGCTTTTGCTGAGACT
ATATCGGTAACAACAAGGAAACCTCGAGAGGGTGAAGTCCCAGGTAAAGA
TTATCATTTTGTTTCCCACGAAGAATTTCAAAGACTTTTGGATCGTCAGG
CTCTCTTAGAATGGGTGTTCTTATTCGGAGAGTGTTACGGAACAAGTATG
TTAGAGATTGAAAGAATTTGGAGCCTAGGGAAGCACGCTGTTGCTGTTAT
TGATATCCAAGGAGCCTTGTTTATTCGCTCTCGGATGCCTAGTGTATCTA
TTTTTATTGCTCCACCTTCACAGGAGGAGTTAGAAAGAAGGTTAGCTTCA
CGGGGATCTGAAGAGGGCTCTCAAAGAAAAGAACGGCTGGAGCACAGTCT
TATTGAGCTAGCAGCTGCAAATCAGTTTGATTATGTCATTATTAACGACG
ACTTAAATCAAGCGTACAGGGTTTTAAAAAGCATTTTTATAGCTGAAGAA
CATAGGAACATATTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy