Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR100 IGR99 IGR94 IGR95 CPn0111 recD, - CPn0123 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 recD, - CPn0123 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 recD, - CPn0123 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 rs16, - CPn0116 gmk, - CPn0120 hemK,yfcB, - CPn0114 rs16, - CPn0116 hemK,yfcB, - CPn0114 CPn0121 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0117

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmD  

Definition:
tRNA (guanine N-1)-methyltransferase

Gene Start:
148989

Gene Stop:
150074

Gene Length:
1086

Molecular Weight*:
41235

pI*:
5.70

Net Charge*:
-7.17

EC:
2.1.1.31  

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table

Secondary Evidence:
Wikstrom PM, Bystrom AS, Bjork GR. 1988. Non-autogenous control of ribosomal protein synthesis from the trmD operon in Escherichia coli. J Mol Biol. 203(1):141-52.

Persson BC, Bylund GO, Berg DE, Wikstrom PM. 1995. Functional analysis of the ffh-trmD region of the Escherichia coli chromosome by using reverse genetics. J Bacteriol 177(19):5554-60.

Bystrom AS, Bjork GR. 1982. Chromosomal location and cloning of the gene (trmD) responsible for the synthesis of tRNA (m1G) methyltransferase in Escherichia coli K-12. Mol Gen Genet 188(3):440-6.

Comment:
This protein is identical to GenBank accession AAD18270 (genome position accession AE001598). This enzyme catalyzes the addition of N(1)-methylguanine to tRNA.

Blast Summary:  PSI-Blast Search
CPn0117 is orthologously related to CT027: residues 1-356 of CPn0117 are 58% similar to residues 1-348 of CT027, t-RNA(guanine-N1) methyltransferase from C. trachomatis.
CPn0117 is also similar to TP0908, UU567, MG445.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0336
COG name: tRNA-(guanine-N1)-methyltransferase
Functional Class:  J
The phylogenetic pattern of COG0336 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 228 (E-value = 2.2e-104) place CPn0117 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

PDB Hit:


Gene Protein Sequence:
MKIDILSLFPGYFDGPLQTSILGRAIKQRLLDVQLTNLRDFGLGKWKQVD
DTPFSGGGMLLMAEPVTSAIRSVRKENSKVIYLSPQGALLTAEKSRELAA
ASHLILLCGHYEGIDERAIESEVDEEISIGDYVLTNGGIAALVLIDAVSR
FIPGVLGNQESAERDSLENGLLEGPQYTRPREFEGKEVPEVLLQGDHKAI
SQWRLEQSERRTYERRPDLYLNYLYKRSIDHKFDEETTTNRDHFKCDKIS
VVLEVNKLKRAKNFYCKVFGLDAMSCENKFCLPHEGKTIFWLREVQAEKK
NIVTLSLSLDCACEEDFCYLLRRWELFGGKLLEKQADEHAVWALAQDLDG
HAWIFSWHRMK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATCGATATACTTTCTTTATTCCCAGGTTATTTTGATGGTCCATT
GCAAACGAGTATTCTTGGTAGGGCCATAAAGCAGAGACTCTTAGATGTCC
AGCTTACAAATCTTCGTGACTTTGGACTCGGAAAGTGGAAACAAGTTGAT
GATACTCCGTTTAGTGGTGGTGGGATGCTTTTAATGGCAGAGCCTGTCAC
TTCAGCTATTAGGAGTGTAAGAAAGGAGAATTCTAAGGTAATTTACCTCT
CTCCTCAAGGAGCTTTGTTGACAGCTGAAAAGAGTCGAGAATTGGCTGCT
GCTTCGCATTTGATATTACTTTGCGGTCACTACGAAGGTATTGATGAGCG
TGCTATAGAGAGCGAAGTGGATGAAGAGATTAGTATAGGGGACTATGTCC
TGACTAATGGTGGAATTGCTGCTCTGGTCCTTATCGATGCAGTTTCTCGT
TTTATTCCCGGTGTATTGGGGAATCAAGAGAGTGCTGAGAGAGATTCTTT
AGAAAATGGTTTGCTAGAAGGACCTCAGTATACACGCCCTAGAGAGTTTG
AAGGGAAAGAAGTTCCAGAAGTATTGTTGCAAGGGGATCACAAAGCCATT
TCTCAGTGGAGATTGGAGCAAAGTGAGCGTAGAACTTATGAGAGACGTCC
TGATTTGTATCTGAACTATCTCTATAAACGCTCGATTGATCACAAATTTG
ATGAGGAGACTACAACAAATAGGGATCATTTCAAGTGTGACAAGATTTCT
GTAGTACTAGAGGTAAATAAGTTAAAGCGCGCAAAAAATTTTTACTGTAA
GGTATTCGGTCTGGATGCCATGAGCTGCGAGAATAAATTTTGTCTTCCTC
ATGAAGGCAAAACCATATTCTGGTTACGAGAAGTTCAAGCTGAGAAAAAA
AACATAGTGACTCTCTCCCTTTCCTTAGATTGTGCATGCGAAGAGGACTT
TTGTTATCTTCTTAGAAGATGGGAGTTATTTGGTGGAAAGTTGTTAGAAA
AGCAAGCTGATGAGCATGCTGTATGGGCCCTAGCACAAGATTTAGATGGG
CATGCATGGATATTCTCGTGGCATAGGATGAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy