Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR100 IGR99 IGR94 IGR93 IGR95 CPn0111 recD, - CPn0123 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 recD, - CPn0123 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 recD, - CPn0123 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 rs16, - CPn0116 gmk, - CPn0120 hemK,yfcB, - CPn0114 rs16, - CPn0116 hemK,yfcB, - CPn0114 CPn0121 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0116

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs16  

Definition:
30S ribosomal S16 protein

Gene Start:
148616

Gene Stop:
148975

Gene Length:
360

Molecular Weight*:
13881

pI*:
11.30

Net Charge*:
15.47

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
Definitely a 30S ribosomal protein S16
sequence over the N-terminal 80
or so residues. S16 sequences range from
82-112 amino acids therefore
at 116 aa, CPn0116 is of satisfactory length
for a full S16. No other
S16 sequence has been reported for the
genome.

Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum, or U. urealyticum.

CPn0116 is orthologously related to CT026:
residues 1-118 is 76% similar to that of CT026.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0228
COG name: Ribosomal protein S16
Functional Class:  J
The phylogenetic pattern of COG0228 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 66 (E-value = 8.2e-15) place CPn0116 in the Ribosomal_S16 family which is described as Ribosomal protein S16 (PF00886)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
60  
119

PDB Hit:


Gene Protein Sequence:
VALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSSINYQL
KSERIFYWLERGAQLSSKAEALVKQGAPGVYSALLSKQEARKLVVRKKRR
AYRQRRSTQREEAAKDATK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCGTTAAAAATTCGTTTAAGACAGCAAGGGCGTAGAAATCATGTTGT
TTATAGATTAGTGCTCGCAGATGTCGAGTCTCCTCGTGATGGTAAATACA
TAGAATTATTAGGTTGGTACGATCCACATAGCTCTATAAATTATCAGCTG
AAAAGTGAACGAATTTTTTATTGGTTAGAGAGGGGAGCCCAACTTTCTTC
GAAAGCTGAAGCTTTAGTAAAGCAGGGAGCTCCAGGAGTGTATAGTGCGC
TATTGTCTAAACAAGAAGCTCGTAAGTTAGTTGTTCGTAAGAAGCGACGT
GCTTATAGACAGCGTCGGTCTACACAAAGAGAAGAGGCTGCAAAAGATGC
AACTAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy