Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR99 IGR94 IGR93 IGR95 CPn0111 lepB, - CPn0110 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 lepB, - CPn0110 CPn0121 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 CPn0111 lepB, - CPn0110 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 metG, - CPn0122 rs16, - CPn0116 gmk, - CPn0120 hemK,yfcB, - CPn0114 rs16, - CPn0116 hemK,yfcB, - CPn0114 CPn0121 gmk, - CPn0120
* Calculated from Protein Sequence

Gene ID: CPn0115

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sr54  ffh  

Definition:
signal recognition particle GTPase protein (SRP) (54 kDa)

Gene Start:
147279

Gene Stop:
148625

Gene Length:
1347

Molecular Weight*:
50598

pI*:
9.30

Net Charge*:
8.01

EC:
 

Functional Class:
cellular processes; standard protein secretion  

Pathway: pathway table

Secondary Evidence:
Samuelsson T, Olsson M, Wikstrom PM, Johansson BR. 1995. The GTPase activity of the Escherichia coli Ffh protein is important for normal growth. Biochim Biophys Acta 1267(2-3):83-91.

Moser C, Mol O, Goody RS, Sinning I. 1997. The signal recognition particle receptor of Escherichia coli (FtsY) has a nucleotide
exchange factor built into the GTPase domain. Proc Natl Acad Sci U S A 94(21):11339-44.

Persson BC, Bylund GO, Berg DE, Wikstrom PM. 1995. Functional
analysis of the ffh-trmD region of the Escherichia coli chromosome by using reverse genetics. J Bacteriol 177(19):5554-60.

Comment:
This protein is identical to GenBank accession AAD18268 (genome position accession AE001598). In E.coli, the signal recognition particle consists of a 4.5 S RNA and the Ffh protein. The SRP bids to the signal peptide to facilitate export of proteins.

Blast Summary:  PSI-Blast Search
CPn0015 is orthologously related to CT025: residues 1-448 are 67% similar to CT025.

Additional significant hits in gapped BLAST to signal recognition particle sequences: residues 1-444 are 37% similar to UU091; residues 1-427 are 36% similar to TP0416; residues 17-444 are 33% similar to MG048; residues 1-421 are 38% similar to (AE001802) signal recognition particle protein [Thermotoga maritima]; residues 4-441 are 38% similar to SR54_STRMU; and residues 1-418 are 38% similar to SR54_ECOLI.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0541
COG name: Signal recognition particle GTPase Ffh
Functional Class:  N
The phylogenetic pattern of COG0541 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 31-412 span six regions of similarity to blocks BL00300A-F (SRP54-type proteins GTP-binding domain proteins) with a combined E-value of 7.5e-74.

ProDom Summary:  Protein Domain Search
Residues 101-293 are 46% similar to a signal recognition particle protein domain of SR54_STRMU. Residues 294-418 are 42% similar to a signal recognition particle protein domain of O67615_AQUAE.

Paralogs:  Local Blast Search
CPn0972, a predicted cell division protein FtsY sequence, is a probable paralog: residues 96-285 are 32% similar to CPn0972.

Pfam Summary:  Pfam Search
Residues 1 to 87 (E-value = 1e-31) place CPn0115 in the SRP54_N family which is described as SRP54-type protein, helical bundle domain (PF02881)
Residues 98 to 295 (E-value = 3.5e-102) place CPn0115 in the SRP54 family which is described as SRP54-type protein, GTPase domain (PF00448)
Residues 326 to 426 (E-value = 1.7e-50) place CPn0115 in the SRP_SPB family which is described as Signal peptide binding domain (PF02978)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
non-globular  
92  
179

PDB Hit:


Gene Protein Sequence:
MINSLSQKLSSIFSFLVSSRRINEENISESIREVRLALLDADVNYHVVKD
FISKVKEKILGEEIWKHVSPGQQFIRCLHEELVAFLSDGREEFTIQKTPS
IILLCGLQGAGKTTTAAKLADYVIKNKKAKKVLVVPCDLKRFAAVDQLKI
LVAQTKAEFYQSQENKPINVVVKALAYAKENGHDFVILDTAGRLNIDNEL
MEELTAIQKVSQANERLFVMNVAMGQDVLATVQAFDQSLDLTGVILSMTD
GDARAGAVFSIKHVLGKPIKFEGCGERIQDLRSFDPQSMAERILGMGDTI
NFVKEMREYISEEEDAELGKKLVTAAFTYEDYYKQMKAFRRMGPLRKLLG
MMPGFNNAKPSQKEIEDSEQQMKRTEAIILSMTPEERKELVELDMSRMKR
IASGCGLTLGDVNQFRKQMSQSKKFFKGMSKGKMEQVRKKMSGGNQWR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAATTCTTTATCGCAAAAGCTATCTTCTATTTTTTCTTTTTTGGT
TTCTTCTCGTAGAATTAATGAAGAAAATATTTCCGAATCTATTAGAGAAG
TTCGTCTGGCTCTCTTGGATGCCGATGTAAATTATCATGTAGTTAAGGAT
TTTATTTCTAAAGTTAAAGAAAAAATCCTTGGAGAAGAGATCTGGAAGCA
TGTTTCCCCAGGGCAACAGTTTATACGTTGTTTGCATGAGGAATTAGTAG
CATTTTTAAGCGATGGAAGAGAAGAGTTTACTATTCAGAAGACGCCTTCG
ATCATCCTTCTTTGCGGACTCCAGGGGGCAGGAAAAACAACAACAGCTGC
TAAGCTTGCTGATTATGTAATTAAGAATAAGAAAGCAAAAAAAGTCCTTG
TGGTTCCTTGTGATCTCAAAAGATTCGCTGCTGTAGATCAATTAAAAATT
TTGGTTGCTCAAACGAAAGCTGAATTTTACCAAAGTCAAGAGAACAAGCC
TATTAATGTTGTTGTTAAAGCGCTTGCATATGCTAAAGAAAATGGTCATG
ATTTTGTGATTCTGGATACTGCAGGGCGTCTCAATATAGATAACGAGCTT
ATGGAAGAGCTGACGGCGATACAAAAAGTTTCTCAAGCTAATGAGCGTCT
TTTTGTGATGAATGTAGCTATGGGGCAAGATGTTTTAGCAACAGTGCAAG
CTTTTGATCAGTCTTTAGATCTTACAGGCGTGATTCTTTCCATGACTGAT
GGAGATGCTCGAGCAGGCGCTGTTTTCTCAATTAAGCACGTCCTTGGTAA
GCCCATTAAATTTGAAGGATGCGGAGAACGCATTCAAGATCTTCGTTCAT
TCGATCCTCAATCTATGGCGGAACGCATTCTTGGAATGGGGGATACCATA
AATTTTGTTAAAGAAATGCGCGAGTATATTTCTGAGGAAGAAGACGCTGA
GCTAGGTAAAAAACTAGTTACTGCGGCTTTTACTTATGAAGACTATTATA
AACAGATGAAAGCATTTCGTCGCATGGGACCTCTAAGAAAACTTTTGGGA
ATGATGCCTGGTTTTAATAATGCGAAACCTAGCCAAAAGGAAATCGAGGA
TTCTGAACAACAGATGAAAAGAACGGAGGCGATTATCCTGTCCATGACTC
CTGAAGAGAGAAAGGAGTTGGTGGAATTGGATATGAGCCGTATGAAGAGG
ATTGCTTCTGGTTGTGGTTTAACTTTAGGCGACGTGAACCAGTTTCGAAA
ACAGATGTCGCAATCGAAAAAATTTTTTAAAGGAATGTCTAAAGGCAAGA
TGGAACAAGTTAGGAAAAAAATGTCAGGAGGAAATCAGTGGCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy