Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR98 IGR92 IGR99 IGR94 IGR93 IGR95 CPn0111 lepB, - CPn0110 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 rl19, - CPn0118 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 rnhB_1, - CPn0119 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 rs16, - CPn0116 hemK,yfcB, - CPn0114 rs16, - CPn0116 hemK,yfcB, - CPn0114 rl19, - CPn0118
* Calculated from Protein Sequence

Gene ID: CPn0113

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prfA  

Definition:
peptide chain release factor I

Gene Start:
145335

Gene Stop:
146408

Gene Length:
1074

Molecular Weight*:
40138

pI*:
5.80

Net Charge*:
-8.16

EC:
 

Functional Class:
translation; translation factors  

Pathway: pathway table

Secondary Evidence:
Nakayashiki,T., Nishimura,K. and Inokuchi,H. 1995. Cloning and sequencing of a previously unidentified gene that is involved in the biosynthesis of heme in Escherichia coli. Gene 153, 67-70.

Comment:
This protein is identical to GenBank accession AAD18266 (genome position accession AE001598). The peptide chain release factor 1 (RF-1) directs the termination of translation in response to the peptide chain termination codons UAG and UAA. RF-2 (gene prfB) mediates UAA and UGA-dependent termination.

Blast Summary:  PSI-Blast Search
CPn0113 is orthologously related to CT023: residues 1-355 of CPn0113 are 76% similar to residues 1-355 of CT023, a predicted peptide chain release factor I from C. trachomatis.

CPn0113 is also similar to TP0051, UU003, MG258, CT459, TP0576, all predicted peptide release factors.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0216
COG name: Protein chain release factor A
Functional Class:  J
The phylogenetic pattern of COG0216 is ----YqvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 62 to 177 (E-value = 2.1e-55) place CPn0113 in the PCRF family which is described as PCRF domain (PF03462)
Residues 210 to 321 (E-value = 3.7e-76) place CPn0113 in the RF-1 family which is described as Peptidyl-tRNA hydrolase domain (PF00472)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
114
coil-coil  
257  
291

PDB Hit:


Gene Protein Sequence:
MKKKVAEYLNRLAEVEIKISNPEIFSNSKEYSALSKEHSYLLELKNAYDK
ILNLEKVLADDKQALAIEKDPEMVVMLEEGINENKVELEKLNKILESLLV
PPDPDDDLNVIMELRAGTGGEEAALFVGDCVRMYHLYASSKGWKYEVLSA
SESDLKGYKEYVMGISGTGVKRLLQYEAGTHRVQRVPETETQGRVHTSAI
TIAVLPEPSEEDTELLINEKDLKIDTFRASGAGGQHVNVTDSAVRITHLP
TGVVVTCQDERSQHKNKDKAMRILKARIRDAEMQKRHNEASAMRSAQVGS
GDRSERIRTYNFSQNRVTDHRIGLTLYNLDKVMEGDLDPITTAMVSHAYH
QLLEHGN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAAAAAGTTGCCGAGTATTTAAACCGTTTAGCAGAAGTCGAAAT
AAAAATTTCAAATCCTGAAATTTTTTCTAATTCTAAAGAATATAGCGCTC
TTAGCAAGGAACATTCTTATCTTCTAGAATTGAAAAACGCCTACGATAAA
ATCTTAAATTTAGAAAAAGTCCTTGCTGATGATAAGCAAGCTTTAGCTAT
TGAGAAAGATCCAGAGATGGTCGTTATGCTTGAAGAGGGGATTAACGAAA
ATAAAGTAGAGCTAGAGAAATTAAATAAAATATTAGAAAGCTTATTAGTC
CCCCCAGATCCTGATGATGATCTAAATGTCATTATGGAACTACGAGCCGG
TACAGGAGGCGAGGAAGCCGCTCTCTTTGTTGGAGATTGTGTCCGCATGT
ATCACCTGTACGCCTCCTCTAAGGGATGGAAATACGAGGTACTCTCTGCG
TCAGAATCCGATCTTAAGGGATATAAGGAATACGTCATGGGGATCTCAGG
AACTGGGGTGAAGCGTTTACTTCAGTATGAGGCTGGTACACATCGAGTTC
AGAGAGTTCCTGAAACAGAAACTCAAGGACGTGTACATACATCTGCAATT
ACAATCGCTGTCCTTCCAGAACCTTCAGAAGAAGATACAGAGCTTCTTAT
TAATGAGAAGGATTTAAAAATTGATACATTCAGAGCCTCTGGTGCTGGAG
GACAGCACGTAAACGTTACTGATTCTGCGGTGAGAATCACACACCTGCCT
ACAGGTGTTGTAGTTACATGCCAGGATGAGCGCAGTCAACATAAAAATAA
AGATAAGGCCATGCGGATTCTTAAAGCCCGGATTCGTGATGCAGAAATGC
AAAAACGCCATAACGAGGCGTCTGCTATGCGTTCTGCTCAGGTAGGAAGT
GGGGATCGTTCCGAGAGAATTCGCACCTATAATTTTTCTCAAAATCGCGT
GACTGATCATAGAATCGGATTAACTTTATATAACTTAGATAAAGTTATGG
AAGGAGACCTAGATCCAATTACGACTGCAATGGTGAGTCATGCCTACCAC
CAGTTACTCGAACATGGAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy