Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR92 IGR94 IGR93 IGR95 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 rs16, - CPn0116 hemK,yfcB, - CPn0114 rs16, - CPn0116 hemK,yfcB, - CPn0114
* Calculated from Protein Sequence

Gene ID: CPn0112

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl31  

Definition:
50S ribosomal protein L31

Gene Start:
144767

Gene Stop:
145096

Gene Length:
330

Molecular Weight*:
12387

pI*:
10.40

Net Charge*:
9.37

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Secondary Evidence:
Lapidus,A., Galleron,N., Sorokin,A. and Ehrlich,S.D. 1997. Sequencing and functional annotation of the Bacillus subtilis genes in the 200 kb rrnB-dnaB region. Microbiology 143 (Pt 11): 3431-41.

Comment:
This protein is identical to GenBank accession AAD18265 (genome position accession AE001597). Ribosomal protein L31 is one of the proteins from the large ribosomal subunit which has only been found so far in eubacteria and in some algal chloroplasts.

Blast Summary:  PSI-Blast Search
CPn0112 is orthologously related to CT022: residues 1-109 is 81% similar to residues 1-108 of CT022.

BLAST reveals no significant similarity to T. pallidum, M. genitalium, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0254
COG name: Ribosomal protein L31
Functional Class:  J
The phylogenetic pattern of COG0254 is -----qvcEBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 81 (E-value = 1.4e-11) place CPn0112 in the Ribosomal_L31 family which is described as Ribosomal protein L31 (PF01197)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
61

PDB Hit:


Gene Protein Sequence:
MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQSEKTEVFEGKEYPVCYVSVS
SSSHPFFTGSKKFVDAEGRVDKFLKRYSNVRQPAQQPQPEEDALPAAKGK
KKVVTKKKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAAATACCCACCCTGAATATAGACAGGTTTTATTTGTAGATTC
TTCAACAGGGTATAAATTTGTTTGTGGATCTACCTATCAAAGTGAAAAAA
CTGAAGTTTTTGAAGGTAAAGAGTATCCTGTATGTTATGTCAGCGTATCC
TCTTCTTCTCATCCTTTTTTCACTGGAAGTAAGAAGTTTGTTGATGCTGA
AGGTAGGGTAGATAAGTTCTTAAAACGTTATAGTAATGTAAGACAGCCTG
CACAGCAACCTCAGCCTGAAGAAGACGCACTACCTGCTGCTAAAGGAAAG
AAAAAAGTTGTAACTAAGAAAAAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy