Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR97 IGR96 IGR92 IGR94 IGR93 IGR95 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 trmD, - CPn0117 sr54,ffh, - CPn0115 ileS, - CPn0109 CPn0111 lepB, - CPn0110 rl31, - CPn0112 prfA, - CPn0113 sr54,ffh, - CPn0115 ileS, - CPn0109 rs16, - CPn0116 hemK,yfcB, - CPn0114 hemK,yfcB, - CPn0114 trmD, - CPn0117 rs16, - CPn0116
* Calculated from Protein Sequence

Gene ID: CPn0111

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
144686

Gene Stop:
143931

Gene Length:
756

Molecular Weight*:
27762

pI*:
10.40

Net Charge*:
8.91

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18264 (genome position accession AE001597).

Blast Summary:  PSI-Blast Search
CPn0111 is orthologously related to CT021: residues 1-241 of CPn0111 are 41% similar to residues 1-241 of CT021, a predicted Chlamydia-specific hypothetical protein (basic) from C. trachomatis.

No similarity to U. urealyticum, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21

PDB Hit:


Gene Protein Sequence:
MKKQGKTLFLFLFLSFLFSTAFSGLFASQTSSLRTIQENIFLAKTGDYTV
LSRGSQRTFVLVKSTTPKTVWIEIIHFPCIAHKERPSLEQASWKTVIHQL
ESPSQVFVVSLSSEGSQFFSLNTRTKSLEPVGKSTTVPAFLQIFDLPLSP
APANVIKTKGKENKPWSPKVSFEGAPLTSISVNAWQGLWPKDRGPLSETG
ILMYFTQPDISVFPLWVSIETPKGTSIVRAVDIGHGATSPYVYSLPDSKT
Q$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGCAAGGAAAAACACTCTTCTTATTCCTCTTTCTATCTTTCCT
CTTCTCGACGGCTTTTTCTGGTCTTTTTGCCTCTCAAACTAGTTCTTTAC
GAACAATTCAAGAAAATATTTTTCTTGCTAAGACTGGAGACTATACTGTT
TTAAGTCGAGGGTCTCAAAGAACGTTTGTTTTAGTCAAATCAACAACCCC
TAAAACCGTTTGGATAGAGATCATCCATTTTCCCTGTATCGCCCATAAAG
AACGCCCTTCTTTAGAACAAGCTTCTTGGAAAACGGTCATTCATCAACTG
GAATCACCTTCACAAGTCTTTGTTGTTTCGCTCTCTTCTGAAGGTTCTCA
GTTTTTCTCTTTAAACACTCGAACCAAGAGCCTAGAGCCTGTAGGAAAAT
CCACTACAGTTCCTGCCTTCTTGCAAATCTTTGATCTTCCTTTATCTCCA
GCTCCCGCAAACGTAATCAAGACTAAAGGAAAAGAAAACAAGCCCTGGTC
TCCCAAAGTTTCTTTTGAAGGGGCTCCACTCACGTCAATCTCTGTGAATG
CATGGCAGGGGCTCTGGCCTAAAGATCGAGGCCCCTTATCAGAAACAGGA
ATCCTTATGTATTTCACCCAACCTGACATTTCTGTGTTTCCTTTATGGGT
GAGTATCGAGACTCCTAAAGGGACTTCTATAGTAAGAGCTGTGGATATAG
GACACGGGGCAACTTCTCCCTATGTCTATTCTCTTCCTGACTCTAAGACA
CAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy