Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR89 IGR92 IGR94 IGR90 IGR93 IGR95 IGR91 CPn0108 CPn0111 CPn0107 lepB, - CPn0110 rl31, - CPn0112 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0111 CPn0107 lepB, - CPn0110 rl31, - CPn0112 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0111 CPn0107 lepB, - CPn0110 rl31, - CPn0112 phoH, - CPn0106 ileS, - CPn0109
* Calculated from Protein Sequence

Gene ID: CPn0109

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
138655

Gene Stop:
141786

Gene Length:
3132

Molecular Weight*:
120285

pI*:
5.50

Net Charge*:
-24.22

EC:
6.1.1.5  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
This sequence is identical to GenBank accession AAD18262 (genome position accession AE001597).

Blast Summary:  PSI-Blast Search
CPn0109 is orthologously related to CT019: residues 4-1031 of CPn0109 are 69% similar to residues 2-1026 of CT019, a predicted isoleucyl-tRNA synthetase from C. trachomatis.

Other significant hits in gapped BLAST to isoleucyl-tRNA synthetase sequences; e.g. residues 4-1031 are 69% similar to CT019; residues 8-1008 are 42% similar to TP0452; residues 14-783 are 29% similar to UU410; residues 8-786 are 27% similar to MG345; residues 8-1010 are 44% similar to (AE001181) isoleucyl-tRNA synthetase (ileS) [Borrelia burgdorferi]; and residues 10-987 are (U04953) isoleucyl-tRNA synthetase [Homo sapiens]. CPn0109 is significantly similar to TP0452. CPn0109 is also similar to TP0452, UU410, MG345, UU267, TP1035, MG334, CT302, MG266, CT209.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0060
COG name: Isoleucyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0060 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 50-59 and 588-598 represent blocks BL00178A,B (Aminoacyl-transfer RNA synthetases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 48-182 are 60% similar to a defined domain of SYI_TETTH.
Residues 509-579 are 71% similar to a defined domain of SYI_HUMAN.

Paralogs:  Local Blast Search
Two probable paralogs were found: residues 1-770 are 22% similar to CPn0094, a predicted valyl tRNA synthetase; and residues 15-198 are 28% similar to CPn0153, a predicted leucyl tRNA synthetase.

Pfam Summary:  Pfam Search
Residues 17 to 632 (E-value = 1.3e-249) place CPn0109 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:


Gene Protein Sequence:
MTADEVGKNSFAKKEEQVLKFWKDNQIFEKSLQNRQGKTLYSFYDGPPFA
TGLPHYGHLLASTIKDVVGRYATMDGYYVPRRFGWDCHGVPVEYEVEKSL
SLTAPGAIEDFGIASFNEECRKIVFRYVHEWEYYINRIGRWVDFSSTWKT
MDASFMESVWWVFQSLYNQGLVYEGTKVVPFSTALGTPLSNFEASQNYKE
VDDPSLVVRMPLQNDSASLLVWTTTPWTLPSNMAIAVGETLVYVRIQDKK
SGEQWILSQGCVSRWFSNPEEFVILESFSGKDLVGRTYEPPFTFFQSKRE
EGAFRVIAASFVEESEGTGVVHMAPAFGEGDFLVCKENHVPLVCPVDAHG
SFTEEIPQYQGQYIKHADKEIIKFLKKEGRIFYHGTVKHRYPFCWRTDTP
LIYKAVNSWFVAVEKIKDKMLRANSSIHWVPEHIQEGRFGKWLEGARDWA
ISRNRYWGTPIPIWKSADGEILVVGSIRELEELTGTQITDIHRHFIDDLN
IVKDGKPFHRIPYVFDCWFDSGAMPYAQNHYPFENQKETEEAFPADFIAE
GLDQTRGWFYTLTVISAILFDRPAFRNAIVNGIILAEDGNKMSKRLNNYP
SPKYVLDTYGADALRLYLLHSVVVKAEDLRFSDKGIEGVLKQILLPLTNV
LSFFNTYAELYGFDPKSQDIEPAYTEIDQWILSNLYSVVGKVRESMSQYH
LNFAVEPFVTFIDDLTNWYIRRCRRRFWEAEDTPDRRAAFSTLYEVLTVF
CKVIAPFVPFLAEDIYQKLKLEKEPESVHLCDFPQVEMDKILPDLEKRMH
DIREIVGLGHSLRKEHKLKVRQPLANFYVVGSKDRLSLLKTFEGLIAEEL
NVKNVIFYEEAPSFIYTTVKPNFRMLGKKVGSKMKEVQKALSELPNNAID
KLIQEETWVLTIDDREIALDGDDVVICRHTDPGYIARSSALFSVILDCQL
REPLIVEGIARELVNKINTMRRNQQLHVSDRIALRIKTTEAVHRAFLDYE
NYICEETLIIAYDFTQDSDFQGENWDINGHATQIEITVSSIDS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGCAGATGAGGTAGGGAAAAATAGCTTTGCAAAAAAAGAAGAACA
GGTTTTGAAGTTTTGGAAAGACAATCAAATTTTTGAAAAGTCTTTGCAAA
ATCGTCAGGGAAAAACCCTATATTCTTTCTATGACGGCCCTCCTTTTGCT
ACAGGTCTTCCACATTACGGTCACTTATTAGCAAGTACCATTAAGGATGT
TGTTGGACGCTATGCTACCATGGACGGGTACTATGTGCCGCGACGTTTTG
GCTGGGATTGCCATGGGGTTCCTGTGGAATATGAGGTGGAAAAGTCTCTG
AGTTTAACAGCACCCGGAGCCATCGAAGATTTTGGTATAGCATCCTTTAA
CGAAGAGTGTCGTAAAATCGTATTTAGATACGTTCACGAGTGGGAATACT
ATATCAATCGTATAGGACGTTGGGTAGATTTTTCTTCTACTTGGAAAACT
ATGGACGCTTCTTTTATGGAAAGTGTCTGGTGGGTTTTCCAATCTCTATA
TAACCAAGGATTAGTGTACGAAGGTACAAAAGTTGTCCCTTTTTCAACAG
CATTAGGAACACCTCTCTCTAATTTTGAAGCAAGCCAAAATTATAAAGAA
GTCGATGACCCGTCTCTTGTTGTAAGAATGCCTCTTCAGAATGATTCCGC
ATCCTTGCTTGTATGGACAACGACTCCATGGACATTGCCTTCTAATATGG
CTATAGCTGTAGGGGAAACTCTGGTTTATGTCCGTATTCAAGATAAAAAA
AGTGGAGAGCAGTGGATCCTAAGTCAGGGATGTGTTTCTCGTTGGTTTTC
AAATCCAGAAGAATTTGTAATTTTAGAGAGTTTTTCTGGGAAAGATCTTG
TTGGTAGGACTTATGAGCCCCCTTTTACTTTTTTCCAATCTAAGCGAGAG
GAAGGAGCTTTTCGTGTCATTGCAGCTTCGTTTGTTGAGGAAAGTGAAGG
AACAGGAGTCGTACATATGGCTCCAGCGTTTGGTGAAGGAGACTTTTTAG
TTTGTAAGGAGAACCATGTTCCTTTAGTCTGTCCTGTAGATGCTCACGGA
AGTTTTACAGAAGAAATACCTCAATATCAAGGGCAATACATTAAACATGC
TGACAAGGAAATCATCAAGTTCTTGAAGAAAGAAGGAAGGATTTTTTACC
ACGGAACAGTAAAACACCGGTATCCTTTCTGTTGGAGAACGGATACTCCT
TTGATTTATAAAGCCGTGAATTCTTGGTTCGTCGCTGTAGAAAAGATTAA
AGATAAGATGCTTCGTGCTAACAGCTCGATCCATTGGGTTCCTGAACATA
TCCAAGAAGGGCGTTTTGGAAAATGGTTGGAAGGCGCTCGTGATTGGGCT
ATCAGTAGAAATCGTTATTGGGGAACGCCAATTCCGATTTGGAAAAGTGC
TGATGGCGAGATTCTTGTTGTAGGATCTATCCGAGAGCTAGAAGAACTTA
CAGGAACTCAGATCACAGATATTCATAGGCATTTTATTGATGATTTGAAC
ATTGTCAAAGATGGCAAGCCCTTTCATCGAATTCCCTACGTTTTTGATTG
CTGGTTCGACTCTGGAGCGATGCCTTATGCCCAAAATCATTATCCTTTTG
AAAATCAAAAGGAAACCGAAGAGGCATTTCCTGCAGACTTTATTGCTGAA
GGGTTGGATCAGACGCGAGGATGGTTTTATACTCTCACAGTGATTTCTGC
AATTTTATTTGATCGTCCTGCATTTCGTAATGCCATTGTGAATGGGATTA
TTCTTGCAGAAGACGGCAATAAAATGTCAAAACGTCTAAATAATTACCCT
AGTCCTAAATACGTTTTAGATACTTATGGAGCTGACGCGCTTCGTCTATA
TTTGCTTCATAGTGTTGTCGTAAAGGCTGAAGATCTTCGCTTTTCTGATA
AAGGAATCGAGGGTGTTTTGAAGCAAATCCTTCTTCCTCTAACGAACGTA
CTTTCCTTTTTTAATACCTATGCCGAGCTGTATGGTTTTGATCCGAAATC
ACAAGATATAGAACCAGCTTATACAGAGATTGATCAATGGATTTTATCCA
ATTTGTATAGTGTTGTAGGTAAAGTTCGTGAGAGCATGAGTCAGTATCAT
TTAAACTTTGCTGTAGAACCCTTTGTGACCTTTATTGATGATCTGACTAA
CTGGTATATACGTCGCTGTCGTAGACGTTTTTGGGAAGCTGAAGATACTC
CTGACCGTAGAGCTGCATTTTCTACTTTATATGAAGTTCTCACAGTTTTT
TGTAAGGTAATTGCTCCCTTCGTTCCTTTTCTTGCCGAAGATATCTATCA
GAAGTTGAAGTTAGAAAAGGAACCTGAATCTGTTCATCTCTGTGATTTTC
CTCAAGTCGAGATGGATAAAATTCTCCCTGATCTAGAAAAGCGTATGCAC
GATATTCGGGAAATCGTAGGTTTAGGCCATTCTTTAAGAAAAGAACACAA
GTTAAAAGTTCGTCAGCCTTTAGCAAACTTTTATGTTGTCGGGTCTAAAG
ATAGATTGTCGCTTCTAAAAACATTTGAAGGGTTGATTGCTGAAGAGCTG
AATGTGAAAAATGTGATTTTCTATGAAGAAGCTCCGAGTTTCATTTATAC
TACCGTCAAACCTAATTTTCGTATGCTTGGGAAAAAAGTTGGATCTAAGA
TGAAAGAGGTCCAAAAAGCTCTCAGTGAACTGCCAAACAATGCTATAGAT
AAGCTGATTCAGGAAGAAACATGGGTTTTAACCATTGATGATAGAGAAAT
AGCTTTGGATGGTGATGACGTCGTGATTTGTCGTCACACAGATCCTGGAT
ATATTGCCCGTAGTTCCGCTCTATTTAGTGTGATTTTAGATTGCCAGTTA
AGAGAACCTCTTATAGTCGAAGGTATAGCAAGAGAGCTAGTCAATAAGAT
TAATACTATGCGTCGAAATCAACAACTTCATGTTTCTGACCGCATCGCAT
TAAGAATAAAAACCACAGAGGCTGTTCATCGCGCTTTCTTGGATTATGAA
AACTATATTTGCGAAGAAACGTTAATTATAGCCTATGATTTTACTCAGGA
TTCTGATTTCCAAGGGGAAAACTGGGATATTAATGGACATGCAACGCAAA
TTGAAATTACAGTTAGTTCTATAGATTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy