Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR89 IGR92 IGR90 IGR87 IGR86 IGR88 IGR91 CPn0108 CPn0107 CPn0105 CPn0104 lepB, - CPn0110 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0107 CPn0105 CPn0104 lepB, - CPn0110 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0107 CPn0105 CPn0104 lepB, - CPn0110 phoH, - CPn0106 ileS, - CPn0109
* Calculated from Protein Sequence

Gene ID: CPn0108

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
137857

Gene Stop:
137300

Gene Length:
558

Molecular Weight*:
20940

pI*:
8.60

Net Charge*:
4.72

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18261 (genome position accession AE001597).

Blast Summary:  PSI-Blast Search
Residues 32-162 are 33% similar to CT018, a hypothetical protein sequence. No significant similarity to M.genitalium, U.urealyticum, T.pallidum, or M.pneumoniae.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
44  
61
transmembrane  
104  
121

PDB Hit:


Gene Protein Sequence:
MSIFNEEVFIISHRHTPLGQTSTALRNTPLVNPLHRTNLQRIASYIPIFS
TFIGIKTLKGISSLQYSMVLMTGNFSSVCKTLPCPEIYEELPKVRKEAWL
EIFGIKALYYLVLGVIKIIKLIVRYLCPCCRPPEPREPQNPLTPTPLDMG
QQIDAIFSTPTSPTGFKDPFLDDLLQEDKKKAPHL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATTTTTAATGAAGAAGTCTTTATAATTAGCCATCGGCACACGCC
TCTGGGTCAAACCTCAACCGCACTAAGAAATACTCCTTTAGTGAATCCCT
TACACCGCACAAATTTACAACGTATTGCAAGCTATATTCCGATATTTAGT
ACATTTATAGGTATCAAAACCTTAAAAGGAATTAGTTCTCTTCAATATTC
TATGGTTCTAATGACAGGGAACTTCTCTTCAGTGTGTAAAACATTACCCT
GTCCTGAGATCTATGAGGAACTTCCTAAAGTTAGAAAAGAAGCTTGGCTA
GAAATTTTCGGCATTAAAGCTCTGTATTACCTGGTCTTAGGAGTCATTAA
GATTATAAAGTTGATCGTTCGGTATCTTTGTCCTTGCTGCCGTCCTCCAG
AGCCAAGAGAACCTCAAAACCCCTTAACACCTACTCCCCTTGACATGGGG
CAGCAAATAGACGCCATATTTTCTACTCCTACCTCTCCAACAGGATTCAA
AGATCCGTTCCTGGATGATCTGTTACAAGAAGATAAAAAAAAAGCCCCCC
ACCTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy