Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR89 IGR90 IGR87 IGR86 IGR88 IGR91 CPn0108 CPn0107 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0107 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 ileS, - CPn0109 CPn0108 CPn0107 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 ileS, - CPn0109
* Calculated from Protein Sequence

Gene ID: CPn0107

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
137162

Gene Stop:
136389

Gene Length:
774

Molecular Weight*:
28513

pI*:
10.20

Net Charge*:
10.49

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18260 (genome position accession AE001597).

Blast Summary:  PSI-Blast Search
CPn0107 is weakly similar to CT058, a predicted hypothetical protein. Residues 36-246 are 26% similar to CT058.
No significant similarity to M.genitalium, T.pallidum, M.pneumoniae, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several probable paralogs were found, all of which are hypothetical protein sequences: residues 8-252 are 39% similar to CPn0369; residues 11-249 are 39% similar to CPn0370; residues 8-128 are 38% similar to CPn0367; and residues 126-206 are 41% similar to CPn0368.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
170  
187

PDB Hit:


Gene Protein Sequence:
MVSPLSLFHKMLLENWTPVEEPFPWPPAEKNQKIFAWALNQSKLIFVSTS
GNIAQPRLVTDSMSMMIVNAANRTMSRDGAGTNQVLSAAVSVDSWGLSQR
PLNPERQGTPLNEGECRAGMWRNADGSNHTGKQGKPHYLAQLLGPKAVDH
HNKSQAAFDRCKNAYLNCFSLAQTLGVTFLQIPLISSGIYAPPENRKKPN
SEENKVRMRWIHAVKCALVAAMQEFGNEPGNTDRRMLIVLTDLKTPAITD
PKKKSHL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTCTCCTCTATCTCTGTTTCATAAGATGCTCTTGGAGAATTGGAC
TCCTGTAGAGGAGCCGTTCCCATGGCCACCAGCAGAAAAAAACCAGAAAA
TCTTTGCCTGGGCACTAAATCAATCAAAGCTGATTTTTGTCTCGACGTCA
GGAAATATTGCACAACCTCGTCTTGTCACTGATAGTATGTCTATGATGAT
TGTAAACGCAGCCAATAGAACAATGAGTCGAGATGGGGCGGGTACAAATC
AAGTTCTATCGGCAGCAGTCAGTGTCGATTCTTGGGGGCTGTCGCAACGA
CCTCTAAATCCTGAACGCCAGGGGACTCCTCTTAATGAGGGTGAATGTCG
GGCAGGCATGTGGAGAAATGCCGATGGATCCAACCACACAGGAAAACAAG
GTAAACCACACTACCTAGCACAACTTCTTGGGCCTAAAGCAGTGGATCAT
CATAACAAGTCTCAAGCAGCCTTTGATCGCTGCAAAAACGCCTACCTAAA
CTGCTTCAGCTTAGCTCAAACTTTAGGTGTAACCTTCCTACAAATCCCTC
TAATTTCTTCTGGGATCTACGCGCCTCCTGAAAATAGAAAAAAGCCTAAT
AGTGAAGAGAATAAAGTCCGCATGAGATGGATACACGCTGTAAAATGCGC
TCTTGTTGCCGCTATGCAAGAATTTGGAAATGAACCCGGAAATACAGACA
GAAGAATGTTGATTGTCCTTACAGACTTGAAAACTCCTGCTATTACAGAT
CCGAAGAAGAAAAGTCACTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy