Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR89 IGR90 IGR87 IGR86 IGR84 IGR88 IGR91 CPn0108 CPn0107 ybbP, - CPn0101 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 ileS, - CPn0109 CPn0108 CPn0107 ybbP, - CPn0101 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 ileS, - CPn0109 CPn0108 CPn0107 ybbP, - CPn0101 CPn0105 CPn0104 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 ileS, - CPn0109
* Calculated from Protein Sequence

Gene ID: CPn0105

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
134847

Gene Stop:
134026

Gene Length:
822

Molecular Weight*:
30703

pI*:
5.60

Net Charge*:
-7.21

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18258 (genome position AE001596).

Blast Summary:  PSI-Blast Search
Residues 29-273 of CPn0105 are 59% similar to residues 1-242 of CT016, a predicted Chlamydia-specific hypothetical protein.
No significant similarity to M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLLIYCKKKEIHLQWPQTAKIRFTPKIAMKVKINDQLICIPPFISARWSQ
IAFIESQEGENKDQGTLRLHLIDGKIISIPNLDQSIIDIAFQEHLLYLET
SQSGKEDSRDDDKLGVGVLMNVLQQITKGNDIQVLPKNLISPLFSGTNPI
EAILQHTPEHKDHPDAPTDVLEKMADVIRVLSGNNATLLPRPEPHCNCMH
CQIGRVMNEEDTLAVSDKDLTFRTWDIMQSGDKLYIVTNPLNPSDQFSVY
LGPPIGCTCGEPNCEHIKAVLYT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGCTAATTTATTGTAAAAAAAAAGAGATACATTTACAATGGCCTCA
AACTGCTAAGATTAGATTCACCCCCAAGATCGCTATGAAAGTCAAAATTA
ATGATCAACTGATTTGTATTCCCCCATTCATCTCTGCAAGATGGAGCCAA
ATTGCATTTATTGAATCCCAGGAAGGAGAAAACAAAGACCAAGGAACACT
AAGGCTCCACCTTATTGATGGCAAAATCATTTCTATTCCTAATTTAGATC
AGTCGATTATTGACATTGCTTTTCAAGAGCACCTTCTCTACCTAGAAACT
TCTCAATCGGGGAAAGAGGATTCTCGTGATGATGATAAACTAGGTGTAGG
GGTCCTTATGAATGTATTGCAGCAGATAACTAAGGGAAACGACATTCAAG
TATTACCTAAAAATCTAATTTCCCCTCTCTTTTCTGGAACAAATCCCATC
GAAGCAATACTACAACATACTCCAGAACATAAAGATCATCCTGATGCTCC
TACCGACGTCTTAGAGAAAATGGCTGATGTCATTCGGGTACTTTCAGGGA
ATAATGCAACGCTTTTACCCAGACCAGAACCCCATTGCAATTGTATGCAC
TGCCAAATTGGAAGGGTCATGAATGAAGAAGATACCCTGGCGGTTTCTGA
TAAAGATCTGACTTTCCGCACTTGGGACATTATGCAAAGTGGGGATAAGT
TGTATATTGTAACGAATCCCTTAAATCCTAGTGATCAGTTTAGCGTCTAC
TTGGGACCCCCCATAGGCTGTACTTGTGGCGAACCCAACTGTGAACATAT
AAAAGCTGTTTTATATACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy