Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR89 IGR90 IGR87 IGR86 IGR84 IGR88 IGR91 CPn0108 CPn0107 CPn0105 CPn0104 CPn0100 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 CPn0108 CPn0107 CPn0105 CPn0104 CPn0100 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 CPn0108 CPn0107 CPn0105 CPn0104 CPn0100 ybbP, - CPn0101 ybbP, - CPn0101 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102
* Calculated from Protein Sequence

Gene ID: CPn0104

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
133875

Gene Stop:
132673

Gene Length:
1203

Molecular Weight*:
44480

pI*:
7.00

Net Charge*:
-0.19

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18257 (genome position accession AE001596).

Blast Summary:  PSI-Blast Search
Residues 38-400 are 56% similar to CT017, a hypothetical protein sequence. No significant similarity to M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
coil-coil  
186  
215
non-globular  
223  
296

PDB Hit:


Gene Protein Sequence:
MRMLQISMLLLALGTAINSPAIYAADSQSVSFPEQLPSSFTGEIKGNHVR
MRLAPHTDGTIIREFSKGDLVAVIGESKDYYVISAPPGITGYVFRSFVLD
NVVEGEQVNVRLEPSTSAPVLVRLSRGTQIQPASQEPHGKWLEVVLPSQC
VFYVAKNFVANKGPIELYTQREGQKKIAMDLINSALNFAHIELEKSLNEI
DLEAIYKKINLVQSEEFKDVPGIQGLIQKALEEIQDAYLSKSLESQNTSI
ASSQCSTPKVSSSEVTTSLLSRHIRKQTALKTAPLTQGRENLEYSLFRIW
ASMQQGNDHSEALTQEAFYRAEQKKKQVLAGVLEVYPHVVKNNPGDYLLK
AQENTIAFLYGTSINLEQWLGKRVTVECLPRPNNHFAFPAYYVVGIKEAS
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAATGCTCCAGATTTCTATGCTTCTTTTAGCTTTAGGAACTGCAAT
CAACTCACCAGCAATCTATGCTGCCGATTCCCAATCCGTATCCTTTCCAG
AACAACTTCCCTCTTCATTTACTGGAGAAATTAAGGGAAACCACGTACGG
ATGCGTCTAGCACCTCATACTGATGGGACCATCATTAGGGAATTTTCTAA
AGGAGATCTTGTTGCTGTTATCGGAGAAAGCAAAGACTACTACGTAATTT
CTGCGCCTCCAGGAATTACAGGTTATGTGTTCCGCTCATTTGTTTTAGAT
AATGTCGTTGAAGGTGAACAAGTCAATGTTCGTTTAGAACCCTCAACATC
AGCTCCAGTACTTGTGAGACTCTCCCGAGGCACACAAATACAGCCAGCTT
CTCAAGAGCCACATGGGAAATGGTTAGAGGTGGTCTTGCCCTCACAATGC
GTATTCTATGTTGCAAAAAACTTTGTTGCTAACAAAGGACCCATCGAGCT
GTATACGCAACGCGAGGGACAAAAAAAGATTGCCATGGACCTTATCAATT
CTGCTTTAAACTTTGCTCATATAGAGCTTGAGAAAAGCCTCAATGAGATT
GATCTGGAAGCAATTTATAAAAAGATCAACCTTGTACAATCCGAAGAGTT
TAAAGATGTTCCAGGAATTCAAGGGCTTATACAAAAAGCTTTAGAAGAAA
TCCAAGATGCCTATCTTTCTAAATCTCTAGAATCTCAAAATACTTCGATT
GCAAGCTCACAATGTTCCACTCCTAAGGTTTCTTCTTCTGAAGTTACAAC
TTCATTACTTTCACGTCATATTCGTAAGCAAACTGCATTAAAAACAGCTC
CTCTTACCCAAGGAAGAGAAAACCTAGAGTATTCTCTCTTCAGAATCTGG
GCCAGTATGCAGCAAGGCAATGACCACTCTGAAGCACTAACACAAGAAGC
GTTTTATCGCGCTGAACAGAAGAAAAAACAAGTGCTTGCGGGTGTATTAG
AAGTGTATCCTCATGTAGTAAAGAACAATCCCGGGGATTACCTACTAAAA
GCTCAGGAAAACACGATTGCTTTTCTTTACGGTACAAGTATCAACTTAGA
GCAATGGTTAGGAAAGCGTGTCACTGTGGAATGTCTCCCACGTCCTAACA
ACCATTTTGCTTTTCCTGCTTATTATGTAGTTGGAATTAAAGAAGCTTCA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy