Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR83 IGR81 IGR82 IGR87 IGR86 IGR84 IGR88 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 CPn0099 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 CPn0099 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydB, - CPn0103 phoH, - CPn0106 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0102

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cydA  

Definition:
cytochrome oxidase D subunit I

Gene Start:
130123

Gene Stop:
131469

Gene Length:
1347

Molecular Weight*:
50664

pI*:
9.00

Net Charge*:
9.32

EC:
1.10.3.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table

Secondary Evidence:
Miller, M. J., and Gennis, R. B. The purification and characterization of the cytochrome d terminal oxidase complex of the Escherichia coli aerobic respiratory chain. J. Biol. Chem. 258, 9159-1965 (1983).

Comment:
This protein sequence is identical to GenBank accession AAD18255 (genome position accession AE001596). Catalyzes the synthesis of ubiquinone-8 from ubiquinol-8. See CPn0103 for the subunit II (cydB). In E. coli, Fnr represses transcription of cydA under anaerobic conditions [see Cotter, P.A., et al., J. Bacteriol. 172(11): 6333-6338 (1990). Also in E. coli, iron-dependent transcription of cydA is independent of Fur. Under anaerobic and iron-limiting conditions, cydA appeared to be elevated slightly (Cotter, P.A., et al., FEMS Microbiol Lett. 79(1-3):227-32 (1992). Also, it is believed that in E. coli the cytochrome b-558-d complex is synthesized as an alternative oxidase for more efficient utilization of oxygen at low oxygen concentration. By changing the contents of the two terminal oxidases, E. coli cells can maintain efficient oxidative energy conservation over a wide range of
oxygen pressures (Kita, K., et al., Methods Enzymol 126:94-113 (1986).

Blast Summary:  PSI-Blast Search
CPn0102 is orthologously related to CT013, a predicted cydA cytochrome oxidase D subunit I: residues 1-447 are 70% similar to CT013.

Numerous significant hits in gapped BLAST to cytochrome oxidase sequences; e.g. residues 2-437 are 37% similar to (AJ235270) cytochrome D ubiquiol oxidase subunit I (cydA) [Rickettsia prowazekii]; residues 1-442 are 35% similar to (AE000736) cytochrome oxidase d subunit I [Aquifex aeolicus]; and residues 6-447 are 32% similar to (AL034355) putative cytochrome oxidase subunit I [Streptomyces coelicolor]. No significant similarity to M. genitalium, U. urealyticum, T. pallidum, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1271
COG name: Cytochrome bd quinol oxidase, subunit 1
Functional Class: C
The phylogenetic pattern of COG1271 is A----q-cEBrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 6-440 are 71% similar to cytochrome oxidase D subunit I in domain of O84016_CHLTR.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 444 (E-value = 1.3e-129) place CPn0102 in the Bac_Ubq_Cox family which is described as Bacterial Cytochrome Ubiquinol Oxidase (PF01654)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
35
transmembrane  
53  
73
transmembrane  
95  
113
transmembrane  
130  
147
transmembrane  
165  
182
transmembrane  
187  
204
transmembrane  
223  
240
transmembrane  
324  
341
transmembrane  
349  
366
transmembrane  
405  
426

PDB Hit:


Gene Protein Sequence:
MDALILSRIQFGLFITFHYLFVPLSMGLSMMLVIMEGLYLVTKKQIYKQM
TWFWVGIFALTFVLGVVTGIMQIFSFGSNWANFSEYTGNIFGTLLGSEGV
FAFFLESGFLGILLFGRHKVSKKMHFFSTCMVALGAHMSAFWIICANSWM
QTPSGYEMVMHKGKLIPALTSFWGVVFSPTTIDRFIHAVLGTWLSGVFLV
ISVSAYYLWKKRHHEFAKQGMKIGTICAVIVLVLQLWSADVTARGVAKNQ
PAKLAAFEGIFKTEEYTPIWAFGYVDMEKERVIGLPIPGALSFLVHRNIK
TPVTGLDQIPRDEWPNVQAVFQLYHLMIMLWGVMVALTLISWSAYKGWRW
ALKPFFLVILTFSVLLPEICNECGWCAAEMGRQPWVVQGLLKTKDAVSPI
VQANQIVQSLVIFSLVFIALLTLFITVLCKKIKHGPEEENDLTEFEVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGCGCTTATCTTATCTAGAATACAATTTGGATTGTTTATAACTTT
TCATTACCTTTTTGTGCCTCTGAGTATGGGTTTGAGCATGATGCTTGTGA
TCATGGAAGGCCTCTACTTGGTTACAAAAAAGCAAATTTATAAGCAAATG
ACATGGTTTTGGGTTGGGATTTTTGCCCTAACATTTGTTCTTGGAGTCGT
TACTGGAATCATGCAGATATTTTCTTTCGGTTCTAACTGGGCAAATTTCT
CAGAATATACAGGAAATATTTTCGGCACCTTATTAGGTAGTGAAGGTGTT
TTTGCTTTTTTCTTGGAATCAGGATTTTTAGGAATTTTGTTATTTGGTCG
CCACAAGGTCTCTAAGAAAATGCATTTCTTTTCTACGTGCATGGTAGCTT
TAGGAGCTCATATGAGTGCCTTTTGGATTATTTGTGCGAATTCTTGGATG
CAGACTCCTTCAGGTTACGAGATGGTGATGCATAAAGGAAAACTCATCCC
TGCTTTAACCTCCTTCTGGGGAGTGGTCTTCTCTCCAACAACTATAGATC
GCTTTATTCATGCAGTCTTAGGAACTTGGCTGTCAGGAGTTTTTCTTGTT
ATAAGTGTATCAGCATATTATTTATGGAAAAAACGTCATCATGAGTTTGC
TAAACAAGGAATGAAGATAGGGACGATTTGTGCAGTTATAGTCTTAGTTT
TACAATTGTGGTCTGCAGATGTAACGGCTAGGGGAGTTGCTAAAAATCAG
CCTGCGAAGTTAGCAGCTTTTGAAGGTATCTTCAAAACCGAAGAATATAC
TCCTATATGGGCTTTTGGTTATGTAGACATGGAAAAAGAACGGGTTATAG
GGCTGCCTATTCCAGGAGCACTTTCTTTTCTTGTTCATAGAAATATAAAA
ACCCCAGTCACTGGTTTAGATCAAATTCCTAGAGATGAATGGCCTAATGT
ACAGGCTGTCTTTCAGCTGTATCACCTGATGATCATGTTGTGGGGGGTTA
TGGTCGCTTTAACTTTGATTTCCTGGTCTGCATATAAGGGATGGCGATGG
GCGTTAAAACCCTTTTTCTTAGTCATTTTAACTTTTTCTGTCTTATTACC
AGAAATTTGTAACGAGTGTGGTTGGTGCGCTGCTGAAATGGGAAGACAAC
CTTGGGTAGTTCAAGGATTATTAAAAACCAAAGATGCGGTGTCTCCTATA
GTGCAGGCGAATCAAATTGTACAATCTTTGGTAATATTTAGCTTAGTATT
CATTGCTCTTCTGACTCTCTTTATTACTGTACTTTGTAAAAAAATAAAGC
ATGGTCCTGAAGAGGAAAATGATCTTACAGAATTTGAAGTGAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy