Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR83 IGR81 IGR82 IGR87 IGR86 IGR84 IGR80 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0105 CPn0104 CPn0100 htrB, - CPn0098 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0101

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ybbP  

Definition:
conserved hypothetical protein

Gene Start:
129932

Gene Stop:
129138

Gene Length:
795

Molecular Weight*:
30223

pI*:
10.30

Net Charge*:
6.69

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18254
(genome position accession AE001596). Possible YbbP protein.

Blast Summary:  PSI-Blast Search
CPn0101 is orthologously related to CT012: residues 5-264 of CPn0101 are 73% similar to residues 5-264 of CT012, a conserved hypothetical protein (basic) from C. trachomatis.
CPn0101 is also similar to TP0826, MG105, both conserved hypothetical proteins.

Numerous significant hits in gapped BLAST to hypothetical protein sequences; e.g. residues 10-243 are 31% similar to (Y15477) hypothetical protein [Staphylococcus aureus]; residues 8-263 are 30% similar to (AB002150) YbbP [Bacillus subtilis]; residues 98-249 are 40% similar to (AJ132706) hypothetical protein [Anabaena variabilis]; residues 5-264 are 73% similar to CT012, a conserved hypothetical protein; residues 8-230 are 33% similar to TP0826, a conserved hypothetical protein; residues 101-250 are 36% similar to MG105, a conserved hypothetical protein; and residues 62-230 are 32% similar to MP0588. No significant similarity to U. urealyticum.



COGS Summary:  COGS Search
BeTs to 9 clades of COG1624
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1624 is am-k-q-c-B----gpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 82-250 are 36% similar to a defined domain of O67447_AQUAE, defined as: PROTEIN CONSERVED MG105 TRANSMEMBRANE 272AA LONG MJ1002 YOJJ HOMOLOG.

Residues 8-89 are 26% similar to a defined domain of Q45589_BACSU, defined as: PROTEIN.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 108 to 231 (E-value = 5e-67) place CPn0101 in the DUF147 family which is described as Domain of unknown function DUF147 (PF02457)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
13  
30
transmembrane  
35  
53
transmembrane  
59  
82
transmembrane  
167  
184

PDB Hit:


Gene Protein Sequence:
MPFDITYYTTPLLEIILIWVMLNYLLKFFWGTRAMDVVFGLLAFLFLFVL
ADKLHLPIIRRLMLHVVNIAAIVVFIIFQPEIRLALSRIRFHGKKFFIDT
QEQFVEQLAASIYQLSERQIGALVVLENKDSFDEYLSFSSVKINATFSEE
LLETIFEPSSPLHDGAVILRGDILAYARVVLPLAHDTTQLSRSMGTRHRA
ALGASQRSDALIITVSEENGSVSLSRDGLLTRGVKIDRFKAVLRSILSPK
EHKRKPLFSWIWKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCTTTGATATTACTTATTATACAACACCTTTGCTAGAAATCATTTT
AATTTGGGTAATGTTAAACTACCTATTAAAATTTTTCTGGGGCACCCGAG
CTATGGATGTTGTCTTTGGCTTGCTTGCGTTTCTCTTTCTATTTGTCCTA
GCCGATAAACTCCACCTCCCTATCATCCGTAGATTGATGCTCCACGTAGT
CAATATCGCTGCCATCGTGGTCTTTATTATTTTCCAACCAGAAATTCGTT
TGGCTCTCTCTCGTATACGATTTCATGGGAAAAAATTCTTCATAGATACT
CAAGAGCAGTTCGTAGAGCAATTAGCTGCCAGTATTTATCAGCTATCAGA
ACGCCAAATCGGGGCTCTTGTTGTTTTAGAAAACAAAGATTCTTTCGATG
AATACCTAAGTTTTTCTTCGGTGAAAATCAATGCAACTTTCTCTGAAGAA
CTTTTAGAGACGATTTTCGAACCTTCATCTCCATTGCACGATGGTGCCGT
CATTCTAAGAGGAGACATTCTAGCCTATGCTCGCGTCGTTCTCCCACTAG
CTCATGATACGACGCAGCTTTCCCGATCCATGGGGACAAGGCATCGCGCA
GCTCTAGGAGCTAGCCAACGATCTGATGCTCTAATTATCACAGTATCTGA
AGAAAATGGAAGTGTCTCTTTGTCTAGAGACGGCCTTCTAACACGCGGAG
TAAAAATAGATAGATTCAAAGCGGTACTCCGCAGTATTCTTTCCCCTAAA
GAACACAAAAGAAAACCTTTATTCTCTTGGATTTGGAAACGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy