Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR83 IGR81 IGR82 IGR86 IGR84 IGR80 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0100

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
129141

Gene Stop:
127879

Gene Length:
1263

Molecular Weight*:
48394

pI*:
7.20

Net Charge*:
0.87

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAD18253
(genome position accession AE001596).

Blast Summary:  PSI-Blast Search
Residues 1-414 are 62% similar to residues 1-415 of CT011, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.    

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
36
transmembrane  
255  
272
transmembrane  
286  
303

PDB Hit:


Gene Protein Sequence:
MIKFLSQLFIRHWPRKVVSLGFAIIIWILVGQSVTITRTLTNVPVRIVDL
HPDQTVLGLQKSGFLNKKVSLTITGNKNTVQDLRPSNLEVVISAANHTES
WIATIDKHNLVSVDHEINIRKDIHSVDANDIFVRLTQYVTEDILLTITKP
IGSPPKGYEYLDVWPKYLNQKVSGPKEYINALKEQGLELTFNLNKISFEE
LERNRIAQGSHDEIIFPIPKEWKKILIPFENTFMDLNDPQADFLRLLFLK
RECIPLNLNLPVFLFFPVTFIQTMNPLEYSLDPVPPIILNHGIHQINIPL
YVKDVSRQFLDVVKNNMVLTIVMPSPQDPSSINWAIEFLDEKTLENTFLQ
TIIAQEHGILHDIALIDEAGIRHRFREYLRKLALFTADGEPLNLIAEIKN
NKVVIQTKTKETTKLYKKEW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAAATTTTTATCTCAACTCTTTATTCGGCATTGGCCTAGAAAAGT
TGTTTCCTTAGGTTTTGCCATCATCATTTGGATCCTCGTAGGACAAAGTG
TTACCATCACGCGAACACTCACAAATGTCCCTGTGCGCATCGTAGACCTA
CATCCAGACCAAACCGTTCTTGGACTACAAAAAAGCGGATTCCTGAATAA
AAAAGTCTCTTTAACAATCACTGGGAATAAAAATACCGTTCAAGACCTCC
GTCCTTCAAATTTAGAGGTAGTGATCAGTGCAGCAAACCATACGGAAAGT
TGGATTGCCACTATAGATAAGCATAACCTTGTCTCTGTAGATCATGAGAT
CAACATACGCAAAGACATCCATAGCGTTGACGCTAACGATATTTTTGTCC
GACTTACACAATATGTAACCGAAGACATTTTATTAACTATAACGAAACCT
ATAGGGAGTCCCCCGAAAGGATATGAGTATTTGGATGTCTGGCCGAAGTA
CTTGAATCAAAAAGTCAGTGGCCCCAAAGAATATATCAATGCTTTGAAAG
AGCAAGGTCTTGAGCTAACCTTTAATTTGAATAAAATTTCGTTCGAAGAG
TTAGAAAGAAATCGCATTGCTCAGGGAAGTCATGACGAAATTATTTTCCC
CATTCCTAAAGAATGGAAGAAAATTTTGATTCCCTTTGAAAATACCTTCA
TGGATCTCAATGACCCTCAAGCAGATTTTCTTCGCCTTTTATTTTTAAAA
AGGGAATGCATTCCCCTAAATTTAAATTTACCGGTCTTTCTATTCTTTCC
TGTAACCTTCATTCAAACGATGAATCCTCTAGAGTACAGCTTAGATCCTG
TCCCTCCCATTATTCTGAATCATGGAATTCATCAAATAAATATTCCTTTA
TATGTTAAGGATGTAAGTAGACAGTTTTTAGATGTCGTAAAGAACAACAT
GGTCTTAACAATTGTGATGCCCTCACCACAAGACCCTTCTTCGATCAACT
GGGCTATAGAATTTTTAGATGAAAAAACTTTAGAAAATACTTTTCTTCAG
ACTATTATAGCCCAAGAACATGGAATTTTACACGATATAGCCCTTATTGA
TGAGGCTGGAATTCGTCATAGATTCCGAGAATATTTAAGAAAGCTTGCAC
TTTTTACAGCAGACGGTGAACCTTTAAATCTTATTGCAGAAATCAAAAAT
AATAAAGTTGTGATCCAGACAAAAACAAAGGAAACAACTAAATTATATAA
AAAAGAGTGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy