Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR83 IGR81 IGR82 IGR86 IGR84 IGR80 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0104 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0099

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
127593

Gene Stop:
127868

Gene Length:
276

Molecular Weight*:
9937

pI*:
11.10

Net Charge*:
7.22

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
This protein sequence can be found in GenBank as accession AAD18252 (genome position accession AE001596).

Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
91

PDB Hit:


Gene Protein Sequence:
MLNSIVTTRTRTAATLLIPKVIPEAPSTPVQIKMISIKETIAVRAKSPAD
TVATFALDSELSEQQQTVLIAASKPRPKQSIKHIKFPLTKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAACAGTATCGTAACTACGAGAACTAGGACAGCAGCAACATTACT
CATTCCGAAAGTCATCCCAGAAGCTCCAAGCACTCCAGTACAAATCAAAA
TGATCAGTATAAAAGAAACAATAGCAGTAAGAGCTAAAAGTCCTGCAGAC
ACTGTCGCTACATTTGCTTTGGATTCTGAGCTATCAGAACAACAACAAAC
TGTGTTGATTGCAGCTTCAAAGCCCCGGCCCAAGCAATCTATTAAGCACA
TAAAGTTTCCCCTAACTAAATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy