Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR85 IGR83 IGR81 IGR82 IGR84 IGR80 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydB, - CPn0103 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0098

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
htrB  

Definition:
lipid A biosynthesis lauroyl acyltransferase

Gene Start:
127491

Gene Stop:
126088

Gene Length:
1404

Molecular Weight*:
53150

pI*:
10.50

Net Charge*:
27.67

EC:
2.3.1.-  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lysine biosynthesis
Lysine degradation
Metabolism of Complex Lipids; Glycerolipid metabolism
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Jones BD, Nichols WA, Gibson BW, Sunshine MG, Apicella MA. Study of the role of the htrB gene in Salmonella typhimurium virulence. Infect. Immun. 65(11):4778-83 (1997).

Karow M, Georgopoulos C. Sequencing, mutational analysis, and transcriptional regulation of the Escherichia coli htrB gene. Mol. Microbiol. 5(9):2285-92 (1991).

Comment:
This protein is identical to GenBank accession AAD18251 (genome position accession AE001596). HtrB is expressed at all temperatures, but accumulation of HtrB transcripts slightly decline with rising temperature, thus its expression is not induced by heat shock.

Blast Summary:  PSI-Blast Search
CPn0098 is similar to CT010, a predicted lipid A biosynthesis lauroyl acyltransferase (HtrB): residues 10-437 are 50% similar to CT010. No similarity to T. pallidum, M. genitalium, M. pneumoniae or U. urealyticum

COGS Summary:  COGS Search
BeTs to 5 clades of COG1560
COG name: Lauroyl/myristoyl acyltransferase involved in lipid A biosynthesis
Functional Class: N
The phylogenetic pattern of COG1560 is --------E-rHuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 314 (E-value = 1.6e-157) place CPn0098 in the Lip_A_acyltrans family which is described as Bacterial lipid A biosynthesis acyltransferase (PF03279)

PDB Hit:


Gene Protein Sequence:
VGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGFLAFYI
ISDYRKTALTNLALAFPEKTFDERYKIARQSLQHLIITLLELLAIEQLVG
NIDKLITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQA
NWELPFLYITKNYPGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQ
QGIEALNQGKLVGIVGDQALLMSSYTYPLFGSPAFTTTSPALLAYKTGFP
VIAVNVSRQAKGFEVIPSAKLYANKSLPMKESVAILMDQMMGFLEKGIAS
QPEQWMWIHKRWKRKISNVIKKKYRYSHILVFVDQVSSHFSFLKALAECF
SGTTLHLALGNADHLEELQEQFPEYSLIQLRNDQDILALPNCYPAIFDLT
NNLQHLYKHFRKTGSCAVYSKRFLEKSLDHPQAPLKNSLRIFYSKNLKDK
ERKNFKVKSKGPRLTVE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGGCAAAAAATTCCATCAGATCAAGAGAACAATCCTAGAAGCCCCTCT
GTATTACCTAGTCTCTGGTATTATTGCTTTATGCAGGCATACCCCAAGAT
CTTTTTTAACAGGATTAGGAAAAGGTTTTGGATTTCTAGCCTTTTATATC
ATCAGCGATTATCGAAAAACAGCCCTCACAAACTTAGCATTAGCGTTTCC
AGAAAAAACATTTGATGAGCGTTATAAAATAGCTCGTCAATCTTTGCAGC
ATCTTATAATTACACTCTTAGAATTACTCGCAATCGAGCAACTTGTCGGA
AATATAGACAAACTCATTACAATCGTGACATCCTCACGAAACCCCAAAGG
TTTTTCTTCTGAAGAGGTCATTTCCAATGAAGATTTAGAGGAAACTTTTA
AGAATCTACAAGAGAAGCAGGGCCTTATTTTATTTTGTGGCCACCAGGCA
AACTGGGAACTTCCTTTTCTTTATATCACTAAAAACTATCCTGGAATCGC
CTTTGCTAAGGCTATAAAAAATCAAAGGCTCAGCAAGAAAATCTTTGCTC
TTAGAGAAGTTTTCAAAGGTAAGATTGTACCCCCAAAAAACGGAATCCAA
CAGGGCATAGAAGCTCTGAATCAAGGGAAACTCGTGGGGATTGTTGGAGA
TCAAGCCTTGTTGATGTCTTCATACACGTATCCTCTCTTTGGCTCTCCAG
CATTCACAACGACATCTCCAGCACTATTAGCTTATAAAACAGGTTTTCCT
GTGATTGCTGTTAATGTTTCTCGCCAAGCTAAAGGCTTCGAAGTGATTCC
GAGTGCCAAGCTGTATGCTAATAAAAGCCTCCCTATGAAAGAATCCGTGG
CTATCCTTATGGATCAGATGATGGGATTTTTAGAAAAAGGGATCGCCAGT
CAGCCTGAACAATGGATGTGGATTCATAAAAGGTGGAAGAGAAAGATCTC
TAACGTAATAAAAAAGAAGTACCGCTATAGCCATATTCTAGTTTTTGTAG
ATCAAGTCTCCTCACACTTTTCTTTTCTGAAAGCTCTAGCAGAATGCTTT
TCAGGAACCACTCTTCATCTAGCACTAGGAAATGCGGATCATCTTGAAGA
ACTTCAAGAACAATTCCCAGAGTACTCCTTGATCCAACTCCGAAATGATC
AAGACATTCTAGCTCTACCGAATTGCTATCCTGCTATTTTTGATCTCACT
AACAATCTACAGCATTTATACAAGCATTTTAGAAAAACAGGTTCTTGTGC
TGTGTACTCTAAAAGATTCCTAGAAAAATCTCTAGACCACCCCCAAGCTC
CTCTAAAAAACTCTTTGAGGATCTTCTATTCTAAAAATCTTAAAGATAAA
GAGAGAAAAAACTTCAAGGTGAAGTCGAAGGGGCCCCGACTTACAGTGGA
GTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy