Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR83 IGR81 IGR82 IGR84 IGR80 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 CPn0099 cydA, - CPn0102 pyk,pk, - CPn0097 CPn0100 htrB, - CPn0098 uvrA, - CPn0096 ybbP, - CPn0101 ybbP, - CPn0101 CPn0099 cydA, - CPn0102 pyk,pk, - CPn0097
* Calculated from Protein Sequence

Gene ID: CPn0097

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyk  pk  

Definition:
pyruvate kinase

Gene Start:
124555

Gene Stop:
126009

Gene Length:
1455

Molecular Weight*:
52656

pI*:
5.30

Net Charge*:
-10.03

EC:
2.7.1.40  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism

Comment:
This enzyme interconverts phosphoenolpyruvate and pyruvate. Magnesium and potassium are said to be required for the reaction. 3D structures are available for eukaryotic enzymes.

From Prosite PDOC00101:

Pyruvate kinase (EC 2.7.1.40) (PK) [1] catalyzes the final step in glycolysis, the conversion of phosphoenolpyruvate to pyruvate with the concomitant phosphorylation of ADP to ATP. PK requires both magnesium and potassium ions for its activity. PK is found in all living organisms. In vertebrates there are four, tissues specific, isozymes: L (liver), R (red cells), M1 (muscle, heart, and brain), and M2 (early fetal tissues). In Escherichia coli there are two isozymes: PK-I (gene pykF) and PK-II (gene pykA). All PK isozymes seem to be tetramers of identical subunits of about 500 amino acid residues.

[ 1] Muirhead H. Biochem. Soc. Trans. 18:193-196(1990).

Blast Summary:  PSI-Blast Search
CPn0097 is similar to MG216 in M. genitalium
and UU186 in U. urealyticum, both predicted
pyruvate kinases.

CPn0097 is orthologously related to CT332:
residues 1-479 are 73% similar to that of CT332.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0469
COG name: Pyruvate kinase
Functional Class: G
The phylogenetic pattern of COG0469 is -m-kY-vCEbrh--gpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 344 (E-value = 1.1e-130) place CPn0097 in the PK family which is described as Pyruvate kinase, barrel domain (PF00224)
Residues 359 to 471 (E-value = 8.2e-09) place CPn0097 in the PK_C family which is described as Pyruvate kinase, alpha/beta domain (PF02887)

PDB Hit:


Gene Protein Sequence:
MITRTKIICTIGPATNSPEMLAKLLDAGMNVARLNFSHGSHETHGQAIGF
LKELREQKRVPLAIMLDTKGPEIRLGNIPQPISVSQGQKLRLVSSDIDGS
AEGGVSLYPKGIFPFVPEGADVLIDDGYIHAVVVSSEADSLELEFMNSGL
LKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIE
TMRKCLADLGNPKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIEL
SVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTRAEVSDIANA
IYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLSHDSFLKLDDSN
SALQVSPYLSAIGLAGIQIAERADAKALIVYTESGSSPMFLSKYRPKFPI
IAVTPSTSVYYRLALEWGVYPMLTQESDRAVWRHQACIYGIEQGILSNYD
RILVLSRGACMEETNNLTLTIVNDILTGSEFPET$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCACACGCACTAAAATTATTTGCACTATAGGGCCAGCAACGAATAG
TCCAGAGATGTTAGCAAAACTTCTAGATGCTGGGATGAACGTAGCAAGAT
TAAATTTCAGTCATGGGAGTCACGAAACTCATGGACAGGCTATTGGATTT
CTCAAGGAGTTAAGGGAGCAGAAGCGGGTTCCTTTAGCAATTATGCTAGA
TACTAAGGGGCCTGAAATTCGTTTAGGGAATATTCCTCAGCCAATTTCGG
TTTCTCAGGGACAAAAGCTTCGTCTGGTAAGTAGTGATATCGATGGGAGT
GCTGAAGGGGGAGTGTCTCTCTATCCTAAGGGGATATTTCCCTTTGTTCC
TGAGGGTGCTGATGTTTTAATAGATGATGGCTACATTCATGCTGTTGTTG
TCTCTTCAGAGGCTGATTCTTTAGAATTAGAGTTTATGAACAGTGGCCTT
CTCAAGTCTCATAAATCTTTGAGTATCCGAGGTGTTGATGTTGCTCTTCC
CTTTATGACAGAGAAAGATATTGCGGATCTTAAGTTTGGGGTAGAGCAGA
ATATGGATGTGGTTGCTGCATCTTTTGTGCGCTACGGTGAAGATATTGAA
ACTATGCGCAAGTGTTTAGCAGACTTAGGCAATCCTAAGATGCCCATCAT
TGCAAAAATAGAAAATCGTTTAGGGGTAGAAAATTTCTCTAAGATTGCCA
AGCTTGCGGATGGAATTATGATTGCTAGAGGAGATTTAGGAATCGAGCTT
TCTGTCGTTGAAGTCCCAAATTTGCAAAAGATGATGGCTAAGGTTTCTAG
AGAAACAGGTCACTTCTGTGTGACTGCAACGCAGATGCTAGAATCTATGA
TTCGCAATGTCTTACCTACACGAGCTGAAGTCTCTGATATTGCCAATGCA
ATTTATGATGGTTCTTCAGCAGTGATGTTGTCAGGGGAAACTGCATCTGG
AGCCCATCCCGTGGCTGCCGTGAAAATCATGCGTTCTGTGATTTTAGAAA
CAGAAAAGAATCTCTCCCATGATTCATTCTTAAAATTAGACGATAGCAAT
AGCGCTCTTCAGGTGTCCCCCTATCTCTCAGCCATTGGATTGGCAGGCAT
TCAGATTGCAGAAAGGGCAGACGCCAAAGCTCTTATTGTTTATACAGAAT
CAGGAAGTTCTCCGATGTTTCTCTCTAAATATCGTCCGAAATTCCCTATC
ATTGCCGTGACTCCAAGCACTTCTGTTTACTATCGCCTAGCTTTGGAATG
GGGGGTCTATCCTATGCTTACCCAGGAAAGTGATCGCGCTGTATGGAGAC
ATCAGGCCTGTATTTATGGCATAGAACAGGGCATTCTCTCTAATTATGAT
CGGATTCTTGTGCTTAGCAGAGGAGCCTGTATGGAAGAAACAAATAATCT
TACCCTGACAATAGTGAATGATATTTTGACTGGGTCGGAATTTCCTGAAA
CCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy