Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR79 IGR78 IGR77 uvrA, - CPn0096 CPn0093 pknD, - CPn0095 valS, - CPn0094 uvrA, - CPn0096 CPn0093 pknD, - CPn0095 valS, - CPn0094 uvrA, - CPn0096 pknD, - CPn0095 valS, - CPn0094 atpK, - CPn0092 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0095

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pknD  

Definition:
probable serine/threonine kinase

Gene Start:
116037

Gene Stop:
118793

Gene Length:
2757

Molecular Weight*:
105816

pI*:
6.00

Net Charge*:
-15.52

EC:
2.7.1.-  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
See CT301.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST over first 300 residues to serine/threonine protein kinase sequences; e.g. residues 1-281 are 34% similar to (AL079308) putative serine/threonine protein kinase [Streptomyces coelicolor]; residues 1-274 are 31% similar to PKN1_MYXXA; residues 1-269 are 33% similar to (AF035395) serine/threonine protein kinase [Pseudomonas aeruginosa]; residues 63-273 are 28% similar to MG109; residues 4-277 are 23% similar to CT673; and residues 63-216 are 28% similar to UU216. No significant similarity to T.pallidum.
CPn0095 is orthologously related to CT301: residues 1-902 of CPn0095
are 47% similar to residues 15-917 of CT301, a predicted S/T protein
kinase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class:  T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 114-144 and 196-211 represent blocks BL00107A-B (Protein kinases ATP-binding region proteins) with a combined E-value of 1.5e-14.
Residues 38-85, 101-123, and 168-217 represent blocks BL00239B,C,E (Receptor tyrosine kinase class II proteins) with a combined E-value of 4e-09.

ProDom Summary:  Protein Domain Search
Residues 1-274 are 31% similar to a defined domain of PKN6_MYXXA, defined as: KINASE PROTEIN TRANSFERASE SERINE/THREONINE-PROTEIN ATP-BINDING RECEPTOR TYROSINE-PROTEIN PHOSPHORYLATION PRECURSOR CELL.

Paralogs:  Local Blast Search
CPn0703 is a possible paralog of CPn0095: residues 35-495 of CPn0095 are 22% similar to residues 63-456 of CPn0703, a predicted S/T protein kinase from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 273 (E-value = 3e-35) place CPn0095 in the Pkinase family which is described as Protein kinase domain (PF00069)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
544  
571
non-globular  
677  
785

PDB Hit:


Gene Protein Sequence:
MGEVYLAYDPVCSRKVALKKIREDLAENPLLKRRFLREARIAADLIHPGV
VPVYTIYSEKDPVYYTMPYIEGYTLKTLLKSVWQKESLSKELAEKTSVGA
FLSIFHKICCTIEYVHSRGILHRDLKPDNILLGLFSEAVILDWGAAVACG
EEEDLLDIDVSKEEVLSSRMTIPGRIVGTPDYMAPERLLGHPASKSTDIY
ALGVVLYQMLTLSFPYRRKKGKKIVLDGQRIPSPQEVAPYREIPPFLSAV
VMRMLAVDPQERYSSVTELKEDIESHLKGSPKWTLTTALPPKKSSSWKLN
EPILLSKYFPMLEVSPASWYSLAISNIESFSEMRLEYTLSKKGLNEGFGI
LLPTSENALGGDFYQGYGFWLHIKERTLSVSLVKNSLEIQRCSQDLESDK
ETFLIALEQHNHSLSLFVDGTTWLIHMNYLPSRSGRVAIIVRDMEDILED
IGIFESSGSLRVSCLAVPDAFLAEKLYDRALVLYRRIAESFPGRKEGYEA
RFRAGITVLEKASTDNNEQEFALAIEEFSKLHDGVAAPLEYLGKALVYQR
LQEYNEEIKSLLLALKRYSQHPEIFRLKDHVVYRLHESFYKRDRLALVFM
ILVLEIAPQAITPGQEEKILVWLKDKSRATLFCLLDPTVLELRSSKMELF
LSYWSGFIPHLNSLFHRAWDQSDVRALIEIFYVACDLHKWQFLSSCIDIF
KESLEDQKATEEIVEFSFEDLGAFLFAIQSIFNKEDAEKIFVSNDQLSPI
LLVYIFDLFANRALLESQGEAIFQALDLIRSKVPENFYHDYLRNHEIRAH
LWCRNEKALSTIFENYTEKQLKDEQHELFVLYGCYLALIQGAEAAKQHFD
VCREDRIFPASLLARNYNRLGLPKDALSYQERRLLLRQKFLYFHCLGNHD
ERDLCQTMYHLLTEEFQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGAAGTCTATCTTGCCTACGATCCTGTATGTTCTCGTAAAGTAGC
TCTTAAAAAAATTCGTGAAGATCTTGCAGAAAATCCTCTTTTGAAAAGGA
GGTTTTTACGAGAGGCAAGAATTGCCGCTGACCTTATTCATCCTGGTGTT
GTTCCTGTCTATACTATTTACAGCGAGAAAGATCCTGTATACTACACGAT
GCCCTACATAGAGGGATATACACTAAAAACCTTACTGAAGAGTGTATGGC
AAAAGGAATCCCTGTCTAAGGAATTAGCAGAGAAAACTTCTGTAGGGGCA
TTTCTTTCTATCTTTCATAAGATCTGCTGCACTATAGAATATGTCCATTC
TCGGGGCATTCTTCATCGCGACCTTAAACCCGATAACATCTTATTAGGTC
TTTTTAGTGAGGCTGTAATCTTAGATTGGGGAGCAGCAGTTGCCTGTGGA
GAAGAAGAGGATCTTCTTGATATAGATGTCAGCAAAGAGGAGGTGCTCTC
TTCAAGAATGACAATTCCAGGAAGAATAGTAGGGACTCCAGATTATATGG
CTCCTGAGAGGCTCCTGGGCCATCCAGCTTCTAAAAGTACAGACATTTAT
GCTTTAGGAGTGGTTCTTTATCAGATGCTCACTCTCTCTTTTCCTTATAG
AAGAAAAAAAGGAAAGAAAATAGTTCTTGACGGTCAGAGAATTCCAAGTC
CTCAAGAGGTAGCTCCTTATCGAGAAATCCCTCCGTTTCTTTCCGCTGTA
GTGATGAGAATGTTGGCTGTAGATCCTCAAGAGCGCTATTCTTCGGTAAC
AGAGCTTAAGGAAGATATCGAGAGTCATCTGAAAGGGAGTCCTAAATGGA
CTTTAACCACAGCCCTGCCACCTAAAAAATCTTCTAGTTGGAAGCTAAAC
GAACCTATTTTACTTTCTAAGTATTTTCCAATGTTGGAGGTCTCTCCAGC
GTCATGGTACAGTTTAGCAATCTCTAATATTGAGAGTTTTTCTGAGATGC
GCTTGGAGTATACTCTTTCTAAAAAAGGCTTGAACGAAGGCTTTGGTATT
TTACTTCCCACGTCAGAAAATGCTTTAGGGGGAGATTTTTACCAGGGGTA
TGGCTTTTGGCTGCATATTAAGGAGAGAACCTTATCCGTGTCTCTGGTGA
AAAATAGCCTAGAAATCCAGAGGTGCTCTCAAGATTTGGAATCTGATAAA
GAGACCTTCTTGATAGCTTTAGAGCAGCATAATCATAGTTTATCTTTGTT
TGTCGATGGTACGACTTGGCTTATCCATATGAATTATCTGCCAAGTCGTA
GTGGGCGAGTCGCTATCATAGTTCGCGATATGGAAGATATCCTGGAAGAT
ATAGGCATTTTTGAAAGTAGTGGCTCTTTGAGGGTCAGTTGTCTTGCTGT
TCCTGACGCTTTTCTTGCTGAGAAGTTATATGATCGCGCTTTAGTGCTTT
ACCGAAGGATCGCAGAATCTTTCCCAGGACGTAAAGAAGGTTATGAAGCA
AGGTTCAGAGCAGGAATTACAGTTTTAGAGAAGGCCTCTACAGATAATAA
TGAACAGGAATTTGCTCTAGCCATTGAAGAATTCTCAAAATTACATGACG
GGGTTGCTGCTCCCTTAGAATACCTTGGTAAGGCTTTAGTATATCAGAGA
CTCCAAGAGTATAATGAAGAAATTAAGAGTTTGCTATTAGCATTGAAACG
TTATTCGCAGCATCCTGAAATCTTTAGGCTTAAAGACCATGTGGTTTACC
GACTCCATGAGAGCTTTTATAAACGGGATCGCCTTGCTCTGGTGTTCATG
ATTTTAGTATTGGAAATAGCTCCCCAGGCAATCACTCCAGGGCAGGAAGA
AAAAATCCTGGTTTGGTTAAAGGACAAATCTCGGGCTACCTTATTTTGCC
TCCTGGATCCCACGGTCTTAGAGCTGCGCTCTTCTAAAATGGAATTATTT
TTAAGTTATTGGTCTGGGTTTATTCCCCATCTCAATAGTCTATTTCATAG
AGCTTGGGATCAAAGCGATGTGCGAGCTTTGATCGAGATTTTCTATGTTG
CTTGTGATCTTCATAAATGGCAGTTTCTCTCTTCTTGTATCGACATATTT
AAAGAGTCTCTTGAGGATCAGAAAGCCACAGAAGAGATTGTTGAGTTCTC
TTTCGAGGATTTAGGGGCATTTCTTTTTGCTATTCAGAGCATCTTTAACA
AGGAAGATGCAGAGAAGATCTTTGTTTCTAATGATCAATTATCGCCAATC
CTTCTTGTTTATATATTCGATCTTTTTGCAAATCGTGCTCTTCTGGAATC
TCAAGGAGAGGCTATTTTTCAGGCTTTGGATCTCATCCGAAGTAAAGTTC
CTGAAAATTTTTATCATGATTACTTGCGGAATCATGAAATCCGAGCGCAT
CTTTGGTGCCGCAATGAGAAGGCTCTAAGCACGATTTTTGAAAACTATAC
AGAGAAACAGCTAAAGGATGAGCAACATGAACTGTTCGTTCTCTATGGAT
GTTACCTTGCTCTTATACAAGGTGCTGAGGCGGCAAAGCAGCATTTTGAT
GTATGTCGTGAAGATCGCATTTTCCCTGCTTCATTATTAGCTAGAAATTA
CAATCGTTTAGGTCTTCCCAAAGATGCTCTTAGCTATCAAGAGCGGCGTT
TGTTATTGCGACAAAAGTTTCTCTATTTCCATTGTCTTGGTAACCACGAC
GAGCGTGACTTATGCCAGACTATGTATCACCTCTTAACCGAAGAATTTCA
GCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy