Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR79 IGR78 IGR76 IGR77 uvrA, - CPn0096 CPn0093 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 uvrA, - CPn0096 CPn0093 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 uvrA, - CPn0096 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 atpD, - CPn0090 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0094

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
valS  

Definition:
valyl-tRNA synthetase

Gene Start:
113152

Gene Stop:
115974

Gene Length:
2823

Molecular Weight*:
107108

pI*:
5.30

Net Charge*:
-23.72

EC:
6.1.1.9  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Valyl-tRNA synthetase is located in the cytoplasm.
Valyl-tRNA synthetase catalyzes ATP + l-valine + tRNA(val) = AMP + pyrophosphate + l-valyl-tRNA(val).
Through similarity Valyl-tRNA synthetase belongs to class-I aminoacyl-tRNA synthetases.

Blast Summary:  PSI-Blast Search
CPn0094 is orthologously related to CT302: residues 1-938 of CPn0094 are 69% similar to residues 1-938 of CT302, a valyl-tRNA synthetase from C. trachomatis.
CPn0094 is also similar to TP1035, UU267, MG334, UU410, MG345, CT019, CT209, TP0452, MG266 (all predicted tRNA synthetases).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0525
COG name: Valyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0525 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0094 is paralogous to CPn0109 (residues 1-744 of CPn0094 are 22% similar to residues 1-770 of CPn0109, isoleucyl-tRNA synthetase) and CPn0153 (residues 22-741 of CPn0109 are 23% similar to residues 15-737 of Cpn0153, leucyl tRNA synthetase).

Pfam Summary:  Pfam Search
Residues 18 to 604 (E-value = 2.3e-202) place CPn0094 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
873  
903

PDB Hit:


Gene Protein Sequence:
MTTEDFPKAYNFQDTEPELYVFWEKNGMFKAEASSDKPPYSVIMPPPNVT
GVLHMGHALVNTLQDVLVRYKRMSGFEVCWIPGTDHAGIATQAVVERHLQ
ASEGKRRTDYSREDFLKHIWAWKEKSEKVVLSQLRQLGCSCDWDRKRFTM
EPLANRAVKKAFKTLFENGYIYRGYYLVNWDPVLQTALADDEVEYEEKDG
WLYYIRYRMVGSQESIVVATTRPETSLGDTGIAVSPNDERYASWIGASVE
VPFVNRQIPIIGDASVDPTFGTGAVKVTPAHDKDDYLMGTNHHLPMINIL
TPSGGINENGGPFAGMAKEKAREEILIALEEQGLFVRKEPYKLRVGVSYR
SGAVIEPYLSKQWFVSVSEFRGALREFVESQDIKIFPKDFVKNYLSWVNH
LRDWCISRQLWWGHRIPVWYHKNDDERVLCYDGEGIPEEVAQDPDSWYQD
PDVLDTWFSSGLWPLTCLGWPDENSPDLKKFYPTALLVTGHDILFFWVTR
MVLLCSSMSGEKPFSEVFLHGLIFGKSYKRYNDFGEWSYISGKEKLAYDM
GEALPDGVVAKWEKLSKSKGNVIDPLEMIATYGTDAVRLTLCSCANRGEQ
IDLDYRLFEEYKHFANKVWNGARFIFGHISDLQGKDLLAGIDEDSLGLED
FYILDGFNQLIHQLEEAYATYAFDKVATLAYEFFRNDLCSTYIEIIKPTL
FGKQGNEASQSTKRTLLAVLLINVLGVLHPVAPFITESLFLRIQDTLGAL
PEGDGDAFTGHALRMLRSRACMEAPYPKAFDVKIPQDLRESFTLAQRLVY
TIRNIRGEMQLDPRLHLKAFVVCSDTTEIQSCIPILQALGGLESIQLLDK
EPEKGLYSFGVVDTIRLGIFVPEEHLLKEKGRLEKERVRLERAVENLERL
LGDESFCQKANPNLVVAKQEALKNNRIELQGILDKLASFA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAGAAGATTTTCCAAAAGCATATAACTTTCAGGATACAGAACC
CGAGTTGTATGTGTTTTGGGAAAAGAATGGGATGTTTAAGGCTGAAGCTT
CGAGTGATAAGCCTCCATATTCTGTAATCATGCCGCCCCCAAATGTTACT
GGGGTTTTGCATATGGGCCATGCTTTGGTCAATACCCTTCAAGATGTTCT
TGTTCGTTACAAACGCATGTCAGGATTTGAAGTTTGTTGGATTCCAGGAA
CTGACCATGCAGGAATTGCTACCCAGGCTGTAGTGGAAAGGCATCTCCAA
GCTTCTGAAGGCAAGCGTCGTACGGACTATAGCCGAGAAGACTTTTTGAA
GCATATTTGGGCATGGAAAGAAAAGAGCGAAAAAGTCGTTCTCTCCCAAC
TGCGACAGCTGGGGTGTTCCTGTGATTGGGATAGGAAACGCTTTACTATG
GAGCCGCTTGCGAATCGTGCGGTCAAAAAAGCTTTCAAAACCCTATTTGA
AAATGGGTATATTTATCGTGGGTACTACCTTGTAAACTGGGATCCTGTTC
TCCAAACCGCCCTGGCGGATGATGAGGTGGAATACGAAGAGAAAGATGGA
TGGCTCTATTATATTCGCTATCGTATGGTAGGTTCTCAAGAGTCTATTGT
TGTAGCAACAACAAGACCCGAAACTTCATTAGGAGACACTGGGATCGCAG
TGTCTCCTAACGACGAGCGCTATGCATCATGGATTGGTGCGAGCGTTGAA
GTGCCTTTTGTAAATCGTCAGATTCCTATCATTGGAGATGCTTCTGTAGA
TCCTACTTTCGGAACAGGAGCTGTAAAAGTGACTCCTGCTCATGATAAGG
ACGATTATCTTATGGGGACCAACCATCATCTTCCTATGATTAACATTCTC
ACCCCCTCAGGAGGAATCAATGAGAATGGTGGACCTTTTGCTGGGATGGC
TAAAGAGAAAGCACGCGAGGAGATCCTCATTGCACTAGAAGAACAGGGGT
TATTTGTAAGGAAAGAGCCTTATAAGCTTCGTGTCGGTGTTTCTTATCGA
TCTGGAGCTGTAATTGAGCCTTATCTTTCTAAACAGTGGTTTGTCTCTGT
GTCAGAGTTCCGTGGAGCTTTGCGAGAGTTTGTAGAAAGTCAAGATATTA
AGATTTTCCCTAAAGACTTTGTCAAAAATTACTTGTCCTGGGTCAACCAC
CTTAGAGATTGGTGTATTAGTAGGCAGCTGTGGTGGGGACATCGTATTCC
TGTTTGGTATCATAAAAATGATGACGAACGGGTCCTTTGTTATGATGGAG
AGGGCATTCCTGAAGAAGTCGCTCAAGATCCTGATTCTTGGTACCAGGAT
CCCGATGTTCTAGATACCTGGTTCTCTTCAGGCTTATGGCCACTGACCTG
CTTGGGGTGGCCTGATGAAAATTCTCCAGATTTGAAGAAATTTTACCCCA
CCGCTCTATTAGTTACAGGGCACGACATCTTGTTTTTCTGGGTAACTCGG
ATGGTGTTACTATGTTCTTCAATGTCAGGGGAAAAGCCTTTTTCAGAAGT
TTTCCTTCATGGATTGATATTTGGGAAGTCTTATAAGCGTTATAACGACT
TTGGTGAATGGTCCTATATTTCTGGGAAAGAGAAGCTAGCTTATGATATG
GGAGAAGCGCTTCCCGATGGTGTTGTTGCCAAATGGGAAAAGCTCTCTAA
ATCCAAAGGGAACGTTATCGATCCTTTAGAGATGATCGCTACTTATGGTA
CCGATGCGGTACGCTTGACTTTGTGTTCTTGTGCAAATCGCGGAGAGCAG
ATAGATCTTGATTACAGGCTATTTGAAGAATACAAGCACTTTGCAAATAA
GGTTTGGAACGGAGCTAGGTTTATCTTTGGTCATATCTCAGATCTTCAGG
GCAAGGATTTGCTTGCAGGTATTGATGAAGACTCTTTAGGGCTTGAAGAT
TTTTATATTTTAGATGGTTTTAACCAACTGATTCATCAGCTTGAGGAGGC
TTATGCTACCTATGCTTTTGATAAAGTGGCAACTTTAGCTTATGAATTTT
TCCGTAATGATCTCTGTTCCACGTATATTGAGATTATTAAACCCACACTC
TTTGGTAAGCAGGGAAACGAGGCTTCGCAATCTACGAAGCGGACCTTACT
TGCTGTTCTTCTTATTAATGTATTAGGAGTTCTTCATCCTGTAGCTCCTT
TCATTACAGAATCTTTATTTTTAAGAATTCAGGATACCTTAGGAGCCCTT
CCTGAAGGAGATGGGGATGCATTTACAGGTCATGCTTTACGTATGCTACG
TTCTCGTGCTTGTATGGAAGCTCCCTATCCAAAAGCTTTTGATGTTAAGA
TACCCCAAGATCTTAGAGAATCTTTTACTTTAGCTCAAAGGCTCGTTTAT
ACTATTAGGAATATCCGTGGGGAGATGCAACTGGATCCGCGTTTACATCT
GAAAGCTTTTGTTGTTTGTTCTGATACTACCGAGATTCAGAGCTGTATCC
CCATACTTCAGGCATTAGGAGGGTTAGAATCTATACAGCTCCTAGATAAA
GAGCCTGAAAAGGGCCTCTATAGCTTTGGTGTTGTTGATACTATACGCCT
GGGGATTTTTGTCCCTGAAGAGCATCTTCTTAAAGAGAAAGGGCGTTTAG
AAAAAGAAAGAGTTAGGTTAGAACGAGCTGTGGAGAACTTAGAGCGCTTA
TTAGGAGATGAGAGTTTTTGCCAAAAGGCAAACCCGAATCTTGTAGTTGC
GAAGCAAGAAGCTTTAAAGAATAATCGTATAGAATTACAAGGCATTCTTG
ATAAGCTTGCATCGTTTGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy