Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR78 IGR76 IGR77 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 atpD, - CPn0090 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0093

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
112509

Gene Stop:
113018

Gene Length:
510

Molecular Weight*:
19253

pI*:
7.60

Net Charge*:
1.62

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0093 is orthologously related to CT303: residues 3-166 of CPn0093 are 55% similar to residues 7-164 of CT303, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
39

PDB Hit:


Gene Protein Sequence:
MQRLGLSNLFHCLLLFLRYYYSKLVFGLTVLLAAISVICLLGCSEPSLSS
FTEYVGPEYSAAAQLSIEQSCHDEVYGQQVVVTWSLPSRMRKCLPVTLYL
WVYYGNGKVEKLTYEVNQSAGYRVYCLKGLEYKELQGIISYRVALCSGNQ
EIVSRRHHLWMEVISLDSP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGCGATTGGGATTGTCGAATCTTTTTCATTGTTTGCTGTTGTTTTT
GCGCTACTACTACTCTAAACTTGTATTTGGGCTTACAGTTCTGTTAGCCG
CAATAAGTGTGATTTGCTTATTGGGTTGTTCAGAACCTTCATTATCTTCT
TTTACAGAATACGTAGGTCCAGAGTATAGTGCAGCAGCCCAACTCAGTAT
CGAGCAGAGTTGTCATGATGAGGTGTATGGACAGCAGGTTGTAGTGACCT
GGAGTCTTCCCTCACGTATGAGGAAATGCCTTCCCGTGACTTTGTATCTC
TGGGTATATTATGGTAATGGCAAGGTAGAGAAATTGACCTATGAGGTCAA
TCAAAGTGCGGGGTATCGAGTGTATTGCCTCAAGGGACTAGAATACAAAG
AACTCCAGGGCATTATCTCCTATCGCGTTGCGTTATGTAGCGGGAATCAA
GAGATTGTGAGTAGGCGTCACCATCTTTGGATGGAGGTTATCTCTCTGGA
TTCTCCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy