Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR78 IGR76 IGR77 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 atpD, - CPn0090 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0092

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpK  

Definition:
vacuolar ATP synthase subunit K

Gene Start:
112151

Gene Stop:
112576

Gene Length:
426

Molecular Weight*:
14190

pI*:
8.20

Net Charge*:
2.27

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
EnergyMetabolism; Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
CPn0092 is similar to TP0430, also a predicted
V-type ATPase subunit K in T. pallidum.

CPn0092 is orthologously related to CT304:
residues 1-140 are 76% similar to residues
8-147 of CT304.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0636
COG name: FoF1-type ATP synthase c subunit/Vacuolar ATPase/archaeal ATP synthase K subunit
Functional Class:  C
The phylogenetic pattern of COG0636 is AmtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
13  
30
transmembrane  
53  
70
transmembrane  
78  
95
transmembrane  
122  
139

PDB Hit:


Gene Protein Sequence:
MIDMSVVGPALVLGLAMIGSAIGCGMAGVASHAVMSRIDEGHGKLIGMSA
MPSSQSIYGFILMLLMQAAIKNGTLSPVGGIAIGLSVGAALLVSSVMQGK
CCVSGIQAYARSSSIYGKCYAAIGIVESFSLFAVVFALLLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGATATGTCTGTTGTTGGGCCTGCTTTGGTTTTAGGCTTAGCTAT
GATTGGAAGTGCTATAGGATGTGGCATGGCTGGAGTCGCTTCACATGCAG
TAATGTCTCGGATAGATGAAGGACATGGGAAGTTGATAGGAATGTCAGCG
ATGCCCTCATCTCAGTCTATCTATGGGTTTATTTTGATGTTGCTGATGCA
AGCAGCAATAAAAAATGGAACCCTATCGCCAGTAGGAGGGATCGCTATAG
GTTTATCTGTGGGAGCCGCCCTTTTAGTATCTTCCGTGATGCAAGGCAAG
TGTTGTGTCAGCGGAATTCAAGCTTATGCTCGATCTTCGTCAATATATGG
GAAGTGTTATGCAGCGATTGGGATTGTCGAATCTTTTTCATTGTTTGCTG
TTGTTTTTGCGCTACTACTACTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy