Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR78 IGR76 IGR77 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 CPn0093 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 pknD, - CPn0095 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 CPn0087 atpD, - CPn0090 CPn0087 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0091

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpI  

Definition:
probable vacuolar ATPase subunit I

Gene Start:
110074

Gene Stop:
112056

Gene Length:
1983

Molecular Weight*:
75569

pI*:
7.00

Net Charge*:
-0.04

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
CPn0091 is similar to TP0429 and TP0533, both
predicted V-type ATPase subunit I in T. pallidum.

CPn0091 is orthologously related CT305:
residues 1-645 are 59% similar to that of CT305.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1269
COG name: Archaeal/vacuolar-type H+-ATPase subunit I
Functional Class:  C
The phylogenetic pattern of COG1269 is amtkY-----------oLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 19 to 641 (E-value = 2e-11) place CPn0091 in the V_ATPase_I family which is described as V-type ATPase 116kDa subunit family (PF01496)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
67  
101
transmembrane  
313  
336
transmembrane  
458  
475
transmembrane  
487  
505
transmembrane  
526  
543
transmembrane  
554  
571
transmembrane  
592  
611

PDB Hit:


Gene Protein Sequence:
VRLNIHKYLFIGRNKADFFSASRELGVVEFISKKCFITTEQGHRFVECLK
VFDHLEAEYSLEALEFVKDESVSVEDIVSEVLTLNKEIKGLLETVKALRK
EIVRVKPLGAFSSSEIAELSRKTGISLRFFYRTHKDNEDLEEDSPNVFYL
STAYNFDYYLVLGVVDLPRDRYTEIEAPRSVNELQVDLANLQREIRNRSD
RLCDLYAYRREVLRGLCNYDNEQRLHQAKECCEDLFDGKVFAVAGWVIVD
RIKELQSLCNRYQIYMERVPVDPDETIPTYLENKGVGMMGEDLVQIYDTP
AYSDKDPSTWVFFAFVLFFSMIVNDAGYGLLFLMSSLLFSWKFRRKMKFS
KHLSRMLKMTAILGLGCICWGTTTTSFFGMSFSKTSVFREYSMTHVLALK
KAEYYLQMRPKAYKELTNEYPSLKAIRDPKAFLLATEIGSAGIESRYVVY
DKFIDNILMELALFIGVVHLSLGMLRYLRYRYSGIGWILFMVSAYLYVPI
YLGTVSLIHYLFHVPYELGGQIGYYGMFGGIGLAVVLAMIQRSWRGVEEI
ISVIQVFSDVLSYLRIYALGLAGAMMGATFNQMGARLPMLLGSIVILLGH
SVNIILSIMGGVIHGLRLNFIEWYHYSFDGGGRPLRPLRKIVCSEDAEAS
GIHLDNNSIV$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTTTAAATATACATAAGTATCTCTTTATAGGACGCAATAAGGCGGA
TTTTTTTTCTGCAAGTAGAGAGCTTGGTGTTGTAGAGTTTATTTCTAAAA
AGTGTTTCATTACCACAGAACAGGGCCATCGTTTTGTAGAATGCTTAAAA
GTTTTTGATCATTTAGAAGCCGAATACTCCTTAGAAGCTTTAGAGTTTGT
TAAAGATGAGAGTGTTTCAGTCGAAGATATTGTCTCCGAGGTCCTTACTT
TAAATAAGGAAATCAAGGGACTTTTAGAAACTGTAAAGGCATTAAGGAAA
GAGATTGTTAGAGTCAAGCCCCTAGGGGCATTTTCTTCTTCAGAGATTGC
AGAGCTGTCTAGAAAGACAGGAATATCTCTACGATTTTTCTATAGGACGC
ATAAAGATAATGAGGATTTAGAGGAGGACTCTCCTAACGTTTTTTATCTT
TCTACAGCGTATAATTTTGATTATTATCTAGTTCTTGGAGTTGTGGATCT
TCCTAGAGATCGCTACACAGAGATTGAAGCTCCACGTTCTGTAAATGAGT
TGCAAGTAGACCTTGCAAATCTTCAGCGCGAGATTAGAAACAGATCCGAC
CGTCTTTGTGATCTCTATGCCTATCGTAGAGAAGTCCTGCGAGGGCTTTG
TAATTATGACAATGAACAAAGGCTTCATCAAGCAAAAGAGTGTTGCGAGG
ACTTGTTCGATGGGAAAGTCTTTGCTGTTGCGGGTTGGGTCATCGTCGAT
AGAATCAAAGAATTACAAAGTCTTTGCAATCGTTATCAAATTTATATGGA
AAGGGTTCCTGTTGATCCTGATGAGACGATCCCTACCTACCTTGAGAATA
AAGGTGTAGGTATGATGGGAGAGGATCTTGTACAGATTTATGATACTCCA
GCATATTCCGATAAAGATCCTTCCACTTGGGTATTTTTTGCTTTTGTGCT
CTTCTTCTCTATGATTGTCAATGATGCTGGCTACGGCCTGCTATTTCTAA
TGTCTTCGCTTCTATTCTCTTGGAAATTCCGTCGTAAGATGAAGTTCTCT
AAACATCTCTCACGCATGCTGAAGATGACCGCTATTTTAGGTCTTGGTTG
TATATGTTGGGGAACGACAACAACTTCATTTTTTGGAATGAGTTTTAGTA
AAACGAGTGTGTTTAGAGAATACTCTATGACGCATGTCTTGGCTTTGAAA
AAGGCCGAATACTACCTGCAAATGCGTCCTAAAGCCTATAAGGAACTCAC
GAATGAGTACCCCTCGTTAAAAGCGATTCGTGATCCCAAGGCCTTCTTGC
TAGCAACTGAAATAGGAAGTGCAGGTATAGAATCTCGTTATGTAGTCTAC
GATAAGTTTATCGATAATATCCTTATGGAATTAGCGCTGTTTATTGGAGT
CGTACACCTTTCCTTAGGTATGTTGCGCTATCTTCGTTATCGTTATTCTG
GCATTGGGTGGATTCTCTTTATGGTTAGCGCCTATCTTTATGTGCCTATT
TATCTTGGTACTGTATCTTTGATTCATTATCTTTTCCATGTTCCCTATGA
ATTAGGAGGACAAATAGGATATTATGGCATGTTTGGTGGAATTGGGCTTG
CTGTTGTACTGGCAATGATACAGAGGAGTTGGCGTGGAGTTGAGGAAATC
ATTTCTGTGATCCAAGTGTTCTCTGATGTTCTCTCGTATCTCCGTATATA
TGCTTTAGGACTTGCTGGTGCTATGATGGGAGCCACGTTTAATCAAATGG
GAGCAAGATTGCCTATGCTTCTTGGTTCTATAGTTATTCTTCTTGGTCAC
TCCGTGAATATCATTCTTTCTATTATGGGAGGAGTGATTCATGGACTTAG
GTTAAATTTTATAGAGTGGTACCACTACAGTTTTGATGGGGGAGGTCGTC
CCTTACGTCCTCTGAGAAAGATTGTCTGTAGCGAAGATGCTGAGGCTTCG
GGGATTCACTTAGATAATAATTCAATAGTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy