Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR74 IGR76 IGR77 IGR73 CPn0093 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 CPn0093 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 CPn0087 atpD, - CPn0090 CPn0087 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0090

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpD  

Definition:
probable ATP synthase subunit D

Gene Start:
109454

Gene Stop:
110083

Gene Length:
630

Molecular Weight*:
23773

pI*:
9.20

Net Charge*:
4.82

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0090 is similar to TP0428, a predicted
V-type ATPase subunit D in T. pallidum.
Residues 5-198 are 33% similar to residues
3-194 of TP0428.

CPn0090 is orthologously related to CT306:
residues 1-202 are 66% similar to that of CT306.



COGS Summary:  COGS Search
BeTs to 6 clades of COG1394
COG name: Archaeal/vacuolar type H+-ATPase subunit D
Functional Class:  C
The phylogenetic pattern of COG1394 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 201 (E-value = 2.3e-44) place CPn0090 in the ATP-synt_D family which is described as ATP synthase subunit D (PF01813)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
78
coil-coil  
132  
164

PDB Hit:


Gene Protein Sequence:
MSVQVKLTKNSFRLEKQKLARLQTYLPTLKLKKALLQAEVQNAVKDAAEC
DKDYVQAYERIYAFAELFSIPLCTDCVEKSFEIQSIDNDFENIAGVEVPI
VREVTLFPASYSLLGTPIWLDTMLSASKELVVKKVMAEVSKERLKILEEE
LRAVSIRVNLFEKKLIPETTKILKKIAVFLSDRSITDVGQVKMAKKKIEL
RKARGDECV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTCCAAGTAAAGCTAACAAAGAACTCCTTTCGACTAGAAAAACA
AAAACTAGCACGATTACAAACGTACCTTCCGACATTAAAACTTAAGAAAG
CTTTATTGCAGGCTGAGGTACAAAACGCTGTTAAAGATGCTGCAGAGTGT
GACAAGGACTATGTACAGGCTTATGAGCGGATTTATGCTTTTGCGGAATT
GTTTAGTATTCCTCTCTGTACAGATTGTGTAGAGAAGAGTTTTGAGATTC
AGAGTATAGATAACGACTTTGAAAACATAGCTGGTGTTGAGGTCCCTATA
GTCCGTGAGGTAACACTATTTCCAGCTTCGTATTCTCTTTTAGGGACCCC
GATATGGTTAGATACGATGCTCTCAGCATCAAAAGAACTTGTGGTCAAAA
AAGTCATGGCCGAAGTCTCGAAAGAACGTCTAAAGATCTTAGAAGAAGAA
TTACGAGCCGTTTCAATTCGAGTCAATTTATTTGAGAAGAAGCTCATTCC
TGAAACTACGAAGATACTCAAGAAGATTGCGGTTTTCTTAAGTGATCGTA
GCATCACCGATGTAGGTCAAGTTAAAATGGCAAAAAAGAAGATAGAACTC
CGGAAAGCAAGGGGGGATGAGTGCGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy