Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR74 IGR76 IGR77 IGR73 CPn0085 CPn0093 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 CPn0085 CPn0093 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 CPn0085 atpE, - CPn0086 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 valS, - CPn0094 atpK, - CPn0092 atpD, - CPn0090 CPn0087 atpD, - CPn0090 CPn0087 CPn0093 atpK, - CPn0092
* Calculated from Protein Sequence

Gene ID: CPn0089

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpB  

Definition:
ATP synthase beta chain

Gene Start:
108153

Gene Stop:
109469

Gene Length:
1317

Molecular Weight*:
48275

pI*:
5.80

Net Charge*:
-4.85

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
EnergyMetabolism; Oxidative phosphorylation

Comment:
The V-type ATPase complex is a multisubunit
complex that
pumps H+ s, typically in intracellular acidic
vacuoles.
Several 3D structures are available for this
protein

Blast Summary:  PSI-Blast Search
CPn0089 is similar to TP0427, TP0528, TP0402
and TP0529 in T. pallidum; UU129, UU132 and
UU054 in U. urealyticum; MG401 and MG399 in
M. genitalium.

CPn0089 is orthologously related to CT307,
a predicted ATP synthase beta chain. Residues
1-432 are 88% similar to residues 1-438 of
CT307.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1156
COG name: Vacuolar ATPase/archaeal ATP synthase B subunit (NtpB)
Functional Class:  C
The phylogenetic pattern of COG1156 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0089 is paralogously related to CPn0707
and CPn0858, both thought to be F-type ATP
synthase, and patially to CPn0088, the alpha
subunit sequence of V-type ATP synthase.
Residues 1-378 are 26% similar to CPn0707 and
residues 8-335 are 25% similar to CPn0858.



Pfam Summary:  Pfam Search
Residues 8 to 72 (E-value = 3.5e-12) place CPn0089 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 167 to 337 (E-value = 1.2e-40) place CPn0089 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
177  
250

PDB Hit:


Gene Protein Sequence:
MQTIYTKITDIKGNLITVEAEGARLGELATITRSDGRSSYASVLRFDLKK
VTLQVFGGTSGLSTGDHVTFLGRPMEVTFGSSLLGRRLNGIGKPIDNEGE
CFGEPIEIATPTFNPVCRIVPRSMVRTNIPMIDVFNCLVKSQKIPIFSSS
GEHHNALLMRIAAQTDADIVVIGGMGLTFVDYSFFVEESKKLGFADKCVM
FIHKAVDAPVECVLVPDMALACAEKFAVEEKKNVLVLLTDMTAFADALKE
ISITMDQIPANRGYPGSLYSDLALRYEKAVEIADGGSITLITVTTMPSDD
ITHPVPDNTGYITEGQFYLRNNRIDPFGSLSRLKQLVIGKVTREDHGDLA
NALIRLYADSRKATERMAMGFKLSNWDKKLLAFSELFETRLMSLEVNIPL
EEALDIGWKILAQSFTSEEVGIKAQLINKYWPKACLSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACAATCTACACAAAAATAACTGATATTAAAGGCAATTTAATCAC
TGTAGAAGCAGAGGGAGCTCGTTTAGGGGAGCTTGCTACAATCACAAGAT
CCGACGGAAGATCTTCGTATGCTTCGGTATTGCGTTTTGACCTTAAGAAA
GTAACTCTCCAGGTTTTTGGTGGCACATCGGGCTTATCCACTGGAGATCA
TGTCACGTTCTTAGGGAGACCCATGGAGGTCACATTTGGGAGCTCATTAT
TAGGCAGACGATTGAATGGTATAGGGAAACCCATTGATAATGAGGGGGAG
TGTTTTGGAGAACCTATAGAGATTGCTACTCCAACATTTAACCCTGTCTG
TCGTATTGTTCCTAGGAGTATGGTACGGACAAATATTCCTATGATTGATG
TTTTCAACTGTTTAGTGAAATCTCAGAAAATTCCTATTTTTTCTTCTTCT
GGAGAACATCATAATGCTTTGTTAATGCGGATTGCTGCACAGACAGACGC
GGATATAGTTGTGATTGGTGGGATGGGGCTTACATTCGTAGATTACAGCT
TTTTTGTTGAAGAGTCTAAGAAGCTAGGATTTGCAGATAAGTGTGTGATG
TTTATTCATAAAGCTGTAGATGCTCCTGTAGAATGTGTTTTGGTTCCTGA
TATGGCCCTAGCTTGTGCTGAAAAATTTGCTGTAGAAGAGAAAAAGAACG
TCTTGGTTTTGCTTACAGACATGACAGCGTTTGCTGATGCTCTTAAGGAA
ATTTCTATCACTATGGATCAAATTCCTGCCAATCGTGGGTACCCCGGTTC
CCTATATTCTGATCTAGCTTTACGCTATGAAAAAGCTGTAGAAATTGCCG
ATGGGGGGTCGATCACCTTAATTACTGTAACTACGATGCCTAGTGACGAC
ATTACACATCCTGTTCCTGATAACACAGGATACATTACAGAGGGACAATT
CTACTTGAGGAATAATCGTATAGATCCGTTTGGTTCTCTTTCAAGATTGA
AGCAGCTGGTCATTGGTAAGGTGACTCGAGAGGATCATGGAGATCTTGCG
AATGCTTTAATTCGTCTTTATGCGGATTCCCGTAAAGCTACAGAAAGAAT
GGCTATGGGATTCAAGTTATCGAATTGGGATAAGAAATTACTTGCGTTTT
CCGAGCTTTTTGAAACTCGTTTGATGAGTTTAGAGGTAAATATTCCTTTA
GAAGAAGCTTTAGATATTGGTTGGAAAATTCTAGCTCAAAGTTTCACTTC
TGAAGAAGTGGGAATTAAAGCCCAGTTAATAAATAAGTATTGGCCAAAAG
CATGTCTGTCCAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy