Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR72 IGR71 IGR74 IGR76 IGR70 IGR73 CPn0085 CPn0084 atpK, - CPn0092 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 CPn0085 CPn0084 atpK, - CPn0092 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 CPn0085 CPn0084 atpK, - CPn0092 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 atpD, - CPn0090 CPn0087 atpD, - CPn0090 CPn0087
* Calculated from Protein Sequence

Gene ID: CPn0088

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpA  

Definition:
ATP synthase subunit A

Gene Start:
106373

Gene Stop:
108148

Gene Length:
1776

Molecular Weight*:
65351

pI*:
5.10

Net Charge*:
-17.42

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ATP synthase subunit A sequences. E.g. residues 1-591 are 97% similar to (AE001594) ATP Synthase Subunit A [Chlamydia pneumoniae]; residues 1-589 are 78% similar to (AE001303) ATP Synthase Subunit A [Chlamydia trachomatis]; residues 10-584 are 51% similar to (AE001220) V-type ATPase, subunit A (atpA-1) [Treponema pallidum]; and residues 33-583 are 50% similar to (AE001122) V-type ATPase, subunit A (atpA) [Borrelia burgdorferi].

CPn0088 is similar to TP0426, TP0529 and TP0402
in T. pallidum; UU129, UU054 and UU132 in U.
urealyticum; MG401 and MG399 in M. genitalium.

CPn0088 is orthologously related to CT308 and
they share 81% similarity.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1155
COG name: Vacuolar ATPase/archaeal ATP synthase A subunit (NtpA)
Functional Class:  C
The phylogenetic pattern of COG1155 is amtKY-----------oLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 76-446 span seven regions of similarity to blocks BL00152A-F (ATP synthase alpha and beta subunits proteins.)

ProDom Summary:  Protein Domain Search
Residues 296-400 are 67% similar to a defined domain of Q56403_THETH, and residues 390-513 are 57% similar to a defined domain of O51121_BORBU, both of which are defined as: ATP TRANSPORT HYDROLASE ION HYDROGEN SYNTHASE SYNTHESIS ATP-BINDING CHAIN SUBUNIT.

Paralogs:  Local Blast Search
Possible paralogs in CPn are: CPn0707, a predicted Yop N (Flagellar-Type ATPase); and CPn0858, a predicted Flagellum-specific ATP Synthase. Residues 217-459 are 29% similar to CPn0707, and residues 214-508 are 24% similar to CPn0858.

Pfam Summary:  Pfam Search
Residues 13 to 77 (E-value = 1.5e-10) place CPn0088 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 261 to 449 (E-value = 9.8e-80) place CPn0088 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 461 to 564 (E-value = 6.7e-11) place CPn0088 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
448  
499
coil-coil  
552  
591

PDB Hit:


Gene Protein Sequence:
MVTVSEQTAQGHVIEAYGNLLRVRFDGYVRQGEVAYVNVDNTWLKAEVIE
VADQEVKVQVFEDTQGACRGALVTFSGHLLEAELGPGLLQGIFDGLQNRL
EVLAEDSSFLQRGKHVNAISDHNLWNYTPVASVGDTLRRGDLLGTVPEGR
FTHKIMVPFSCFQEVTLTWVISEGTYNAHTVVAKARDAQGKECAFTMVQR
WPIKQAFIEGEKIPAHKIMDVGLRILDTQIPVLKGGTFCTPGPFGAGKTV
LQHHLSKYAAVDIVILCACGERAGEVVEVLQEFPHLIDPHTGKSLMHRTC
IICNTSSMPVAARESSIYLGVTIAEYYRQMGLDILLLADSTSRWAQALRE
ISGRLEEIPGEEAFPAYLSSRIAAFYERGGAITTKDGSEGSLTICGAVSP
AGGNFEEPVTQSTLAVVGAFCGLSKARADARRYPSIDPLISWSKYLNQVG
QILEEKVSGWGGAVKKAAQFLEKGSEIGKRMEVVGEEGVSMEDMEIYLKA
ELYDFCYLQQNAFDPVDCYCPFERQIELFSLISRIFDAKFVFDSPDDARS
FFLELQSKIKTLNGLKFLSEEYHESKEVIVRLLEKTMVQMA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAACAGTTTCAGAACAAACTGCTCAGGGACATGTTATAGAAGCTTA
TGGAAACTTGTTACGTGTACGCTTTGACGGATATGTTAGACAAGGTGAAG
TTGCATATGTCAACGTAGATAATACCTGGTTAAAAGCAGAAGTGATTGAA
GTTGCTGATCAAGAAGTCAAGGTTCAGGTATTTGAAGATACACAAGGCGC
GTGTCGAGGAGCTCTTGTTACGTTTTCAGGACATCTTTTAGAAGCCGAGT
TAGGGCCTGGCTTGCTTCAGGGCATTTTCGATGGACTTCAAAATCGTCTT
GAGGTGCTAGCTGAAGATAGTTCTTTCTTGCAGAGAGGCAAGCATGTTAA
TGCTATTTCTGATCATAATTTATGGAATTATACTCCCGTAGCTTCTGTTG
GGGATACTTTAAGACGAGGAGATCTTCTAGGAACAGTACCTGAAGGACGA
TTTACTCATAAGATTATGGTTCCTTTTTCTTGCTTTCAAGAGGTTACCCT
GACTTGGGTAATTTCTGAAGGAACCTATAATGCTCATACTGTGGTCGCAA
AAGCTCGAGATGCTCAGGGTAAAGAATGTGCCTTTACTATGGTGCAAAGA
TGGCCGATCAAACAAGCTTTTATTGAAGGAGAGAAGATCCCTGCGCATAA
GATTATGGATGTGGGTTTGCGAATCTTAGATACGCAAATTCCAGTATTGA
AGGGGGGAACTTTCTGTACCCCAGGACCTTTTGGTGCAGGGAAAACAGTC
TTACAACACCATCTTTCTAAGTACGCTGCTGTAGATATTGTGATTTTGTG
TGCGTGCGGAGAGCGTGCTGGTGAAGTTGTTGAGGTATTACAAGAGTTCC
CTCATCTTATCGACCCCCATACCGGAAAGTCTTTAATGCACAGAACATGT
ATTATTTGTAACACATCATCCATGCCTGTGGCTGCCCGAGAGTCTTCGAT
CTATTTAGGAGTGACGATTGCAGAATACTATCGCCAGATGGGACTAGATA
TTCTGCTTTTAGCTGATTCTACATCCCGATGGGCACAAGCCCTTAGAGAG
ATTTCGGGACGTCTTGAAGAAATCCCTGGAGAGGAAGCATTTCCTGCATA
CCTGTCTTCTAGAATAGCTGCTTTTTATGAGCGAGGAGGAGCTATCACCA
CGAAAGATGGTTCTGAAGGATCTTTAACTATATGTGGTGCGGTGTCTCCT
GCAGGAGGAAACTTTGAAGAACCAGTCACTCAATCTACATTAGCTGTAGT
CGGAGCGTTCTGTGGTCTTTCAAAAGCACGAGCTGACGCACGTAGGTATC
CTTCAATAGACCCTTTGATTTCTTGGTCAAAATATTTGAACCAGGTAGGA
CAAATTTTAGAAGAGAAGGTTTCAGGCTGGGGTGGTGCTGTGAAAAAAGC
AGCACAGTTTCTAGAGAAAGGTTCAGAAATCGGCAAGCGTATGGAAGTTG
TCGGTGAAGAAGGGGTTTCTATGGAAGACATGGAAATCTACTTAAAGGCA
GAACTTTATGATTTTTGTTATCTCCAGCAGAACGCATTCGATCCTGTGGA
CTGTTATTGTCCTTTTGAGAGACAGATAGAGTTATTTTCATTAATCAGTC
GTATTTTTGATGCTAAATTTGTTTTTGATAGTCCTGATGATGCAAGAAGC
TTTTTCCTTGAGCTGCAGAGCAAGATTAAGACATTAAATGGCCTGAAATT
TCTTTCAGAGGAATATCATGAGAGTAAAGAGGTCATAGTTAGACTGTTGG
AAAAAACAATGGTACAAATGGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy