Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR72 IGR71 IGR74 IGR70 IGR73 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 rpoC, - CPn0082 atpD, - CPn0090 CPn0087 atpD, - CPn0090 CPn0087
* Calculated from Protein Sequence

Gene ID: CPn0087

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (possibly related to V-ATP synthase)

Gene Start:
105579

Gene Stop:
106379

Gene Length:
801

Molecular Weight*:
31280

pI*:
4.50

Net Charge*:
-15.68

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0087 is orthologously related to CT309: residues 1-266 of CPn0087 are 60% similar to residues 1-266 of CT309, a predicted hypothetical protein (possibly related to V-ATP synthase) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
212

PDB Hit:


Gene Protein Sequence:
MTQYYFLSSFLPTQLPESVPLFSISDLDDLLYLNLSENDLCNYGLLKRFF
DFENFAFFWAGKPIPFSFGEVTQENVERMLSSQQWSDDNDFEDFFKDFLM
NHKSSQDRLNHFSDLFREFLSYHQTNSSKFLQDYFRFQQQLRVVLAGFRA
RVLNMDVSYVLRDEDSSDPVVLEVLMQKDSPNYELPEEFSDLQGVLDDYG
LLPHTLNRALALYQFHKLEGFCSDSYFDGNVILARCATYMFAIRNSLASV
EKGREIINHIEKAIKW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCAATATTATTTTTTATCTTCATTTTTACCTACTCAGCTACCAGA
ATCCGTACCTCTATTTTCTATTTCGGACTTAGACGATCTACTTTATTTAA
ACCTATCAGAAAACGATCTTTGCAATTACGGACTTCTTAAACGTTTTTTT
GATTTCGAAAATTTCGCTTTCTTTTGGGCTGGTAAACCGATTCCCTTCTC
TTTTGGGGAGGTGACTCAGGAAAATGTAGAAAGAATGCTTTCCTCTCAGC
AGTGGTCTGATGACAATGATTTTGAAGATTTCTTTAAGGATTTTTTAATG
AATCATAAGTCTTCTCAAGATCGTTTGAATCACTTTTCAGATTTATTTAG
AGAGTTTCTTTCCTATCATCAAACGAATTCTTCAAAGTTTCTTCAAGATT
ATTTCAGATTTCAACAACAACTTCGTGTTGTACTCGCGGGATTCCGTGCA
AGAGTCTTGAATATGGATGTTTCCTATGTTTTGCGCGACGAAGATAGTTC
CGATCCAGTTGTGCTCGAGGTGCTCATGCAGAAAGATTCTCCTAATTATG
AGCTTCCTGAAGAGTTTTCGGATTTACAGGGCGTTTTGGATGACTACGGC
CTCTTGCCTCATACACTGAATCGTGCGCTTGCCCTATACCAATTTCATAA
ACTCGAGGGATTTTGTTCTGACTCCTACTTTGATGGGAATGTCATTTTAG
CAAGATGTGCTACATATATGTTTGCTATTCGTAACAGCTTAGCAAGTGTT
GAAAAAGGAAGAGAAATTATTAATCATATAGAAAAGGCAATCAAATGGTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy