Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR72 IGR71 IGR74 IGR70 IGR73 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 atpI, - CPn0091 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 rpoC, - CPn0082 atpD, - CPn0090 CPn0087 CPn0087 atpI, - CPn0091 atpD, - CPn0090
* Calculated from Protein Sequence

Gene ID: CPn0086

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpE  

Definition:
possible ATP synthase subunit E

Gene Start:
104904

Gene Stop:
105530

Gene Length:
627

Molecular Weight*:
23038

pI*:
8.40

Net Charge*:
1.93

EC:
 

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
EnergyMetabolism; Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
CPn0086 is similar to TP0324 in T. pallidum.

CPn0086 is orthologously related to CT310 and
they share 71% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
26  
91
non-globular  
117  
208

PDB Hit:


Gene Protein Sequence:
MANLNADGKLKQICDALRLDTLKPAEDEAAALLHNAKEQAKRIIQEAQEE
ARKILETAEERAHQKIKQGEVALSQAGKRALEALKQAVENKIFRESLVEW
LEHVTTDPEVSTKLIQALVQALEAQGVSGNLTAYIGKHVSPRAVNELLGK
AVTTKLRKKSVVVGSFVGGVQLKVEEKNWVLDLSSSALLEIFTRYLQKDF
REMIFQGS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAATCTTAATGCCGATGGTAAGCTTAAGCAAATCTGCGATGCTTT
GCGTTTAGACACTCTAAAGCCTGCAGAAGACGAGGCTGCGGCGTTATTGC
ATAATGCTAAAGAACAAGCGAAAAGAATTATTCAAGAAGCTCAAGAAGAA
GCCAGAAAAATCTTAGAGACGGCAGAAGAGAGAGCTCATCAAAAGATAAA
ACAAGGCGAAGTTGCTCTAAGCCAAGCAGGGAAGCGCGCTTTGGAAGCCT
TAAAACAGGCTGTAGAAAACAAAATATTTAGAGAGTCTTTAGTAGAGTGG
CTGGAGCATGTAACCACCGATCCTGAGGTTTCTACAAAGTTAATTCAAGC
TTTAGTGCAGGCTTTGGAAGCTCAAGGGGTTTCAGGAAATCTGACCGCCT
ATATAGGAAAACATGTGAGTCCTAGAGCTGTTAATGAGCTCCTAGGAAAG
GCTGTAACAACAAAACTACGAAAGAAAAGTGTAGTTGTTGGAAGTTTTGT
TGGTGGTGTTCAATTAAAAGTTGAAGAAAAGAACTGGGTTCTGGATCTTA
GTTCCTCAGCTCTTCTTGAGATTTTCACACGTTATTTGCAGAAAGATTTT
CGTGAAATGATTTTTCAAGGATCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy